Practical AI workflows, prompts, scripts, and tool reviews for engineers running real infrastructure — Linux, OpenStack, GitLab, Prometheus, Kubernetes.https://devopsaitoolkit.com/en-ushttps://devopsaitoolkit.com/blog/ai-assisted-aws-well-architected-review/https://devopsaitoolkit.com/blog/ai-assisted-aws-well-architected-review/Well-Architected reviews stall because nobody has time. Here's how to use AI to draft findings against the six pillars while you keep judgment and prioritization.Sun, 21 Jun 2026 00:00:00 GMTawsawsaiwell-architectedarchitecturereviewhttps://devopsaitoolkit.com/blog/aws-cost-optimization-with-ai-rightsizing-and-savings-plans/https://devopsaitoolkit.com/blog/aws-cost-optimization-with-ai-rightsizing-and-savings-plans/The AWS bill grows quietly until someone notices. Here's how to use AI to read Cost Explorer and CUR data, then rightsize and commit without overcommitting.Sun, 21 Jun 2026 00:00:00 GMTawsawsaicostfinopssavings-planshttps://devopsaitoolkit.com/blog/azure-cost-management-with-ai-rightsizing-reservations/https://devopsaitoolkit.com/blog/azure-cost-management-with-ai-rightsizing-reservations/Most Azure overspend is idle resources and on-demand VMs that should be reserved. Here's how AI reads cost exports, finds rightsizing wins, and models reservations before you commit.Sun, 21 Jun 2026 00:00:00 GMTazureazureaifinopscost-managementreservationshttps://devopsaitoolkit.com/blog/azure-key-vault-secrets-and-rotation-with-ai/https://devopsaitoolkit.com/blog/azure-key-vault-secrets-and-rotation-with-ai/Stale secrets and over-broad Key Vault access policies are quiet liabilities. Here's how AI helps audit access, draft rotation, and migrate to RBAC without breaking your apps.Sun, 21 Jun 2026 00:00:00 GMTazureazureaikey-vaultsecretssecurityhttps://devopsaitoolkit.com/blog/azure-policy-as-guardrails-with-ai/https://devopsaitoolkit.com/blog/azure-policy-as-guardrails-with-ai/A wiki page saying 'always tag resources' is not a control. Here's how AI helps you author Azure Policy definitions, decode compliance results, and turn standards into enforced guardrails.Sun, 21 Jun 2026 00:00:00 GMTazureazureaiazure-policygovernancecompliancehttps://devopsaitoolkit.com/blog/cutting-lambda-cold-starts-and-cost-with-ai/https://devopsaitoolkit.com/blog/cutting-lambda-cold-starts-and-cost-with-ai/Lambda cold starts and bills creep up quietly. Here's how to use AI to read traces and cost data, then cut latency and spend without guessing at memory sizes.Sun, 21 Jun 2026 00:00:00 GMTawsawsailambdaserverlesscosthttps://devopsaitoolkit.com/blog/debugging-azure-app-service-and-functions-with-ai/https://devopsaitoolkit.com/blog/debugging-azure-app-service-and-functions-with-ai/A 500 with no stack trace, a Function that won't trigger, a cold start that times out. Here's how AI helps you read App Service logs, decode binding errors, and find the real cause.Sun, 21 Jun 2026 00:00:00 GMTazureazureaiapp-servicefunctionstroubleshootinghttps://devopsaitoolkit.com/blog/debugging-cloud-run-and-cloud-functions-with-ai/https://devopsaitoolkit.com/blog/debugging-cloud-run-and-cloud-functions-with-ai/Serverless on GCP fails in ways logs barely explain: cold starts, container contract violations, IAM denials. Here's how I use AI to decode Cloud Run and Cloud Functions failures.Sun, 21 Jun 2026 00:00:00 GMTgcpgcpaicloud-runserverlessdebugginghttps://devopsaitoolkit.com/blog/debugging-nsg-vnet-connectivity-with-ai/https://devopsaitoolkit.com/blog/debugging-nsg-vnet-connectivity-with-ai/Half of Azure networking tickets are an NSG rule, a missing route, or a subnet you forgot. Here's how AI helps you read rule tables, decode Network Watcher output, and stop guessing.Sun, 21 Jun 2026 00:00:00 GMTazureazureainetworkingnsgtroubleshootinghttps://devopsaitoolkit.com/blog/debugging-vpc-connectivity-with-ai-routes-nacls-and-security-groups/https://devopsaitoolkit.com/blog/debugging-vpc-connectivity-with-ai-routes-nacls-and-security-groups/Connection timed out, no logs, no clues. Here's how to use AI to reason through VPC routing, NACLs, and security groups so you find the broken layer fast.Sun, 21 Jun 2026 00:00:00 GMTawsawsaivpcnetworkingtroubleshootinghttps://devopsaitoolkit.com/blog/debugging-vpc-firewall-and-routing-with-ai/https://devopsaitoolkit.com/blog/debugging-vpc-firewall-and-routing-with-ai/When traffic vanishes inside a GCP VPC, the cause is buried in firewall priorities, route tables, and implied rules. Here's how I use AI to decode the path packets actually take.Sun, 21 Jun 2026 00:00:00 GMTgcpgcpaivpcnetworkingfirewallhttps://devopsaitoolkit.com/blog/diagnosing-ecs-fargate-task-failures-with-ai/https://devopsaitoolkit.com/blog/diagnosing-ecs-fargate-task-failures-with-ai/Fargate tasks die with cryptic stopped reasons and no SSH. Here's how to use AI to decode stopped reasons, exit codes, and task definitions to find the real cause.Sun, 21 Jun 2026 00:00:00 GMTawsawsaiecsfargatecontainershttps://devopsaitoolkit.com/blog/gcp-cost-optimization-with-ai-cuds-and-rightsizing/https://devopsaitoolkit.com/blog/gcp-cost-optimization-with-ai-cuds-and-rightsizing/GCP bills are a haystack of SKUs, idle resources, and missed commitments. Here's how I use AI to read billing exports, find waste, and decide between CUDs and rightsizing.Sun, 21 Jun 2026 00:00:00 GMTgcpgcpaifinopscost-optimizationbillinghttps://devopsaitoolkit.com/blog/least-privilege-entra-id-azure-rbac-with-ai/https://devopsaitoolkit.com/blog/least-privilege-entra-id-azure-rbac-with-ai/Owner on a subscription is a liability, not a convenience. Here's how AI helps you draft scoped Azure RBAC, decode role definitions, and find the over-privileged principals you forgot about.Sun, 21 Jun 2026 00:00:00 GMTazureazureairbacentra-idsecurityhttps://devopsaitoolkit.com/blog/least-privilege-gcp-iam-with-ai/https://devopsaitoolkit.com/blog/least-privilege-gcp-iam-with-ai/GCP IAM is a sprawl of predefined roles and primitive grants that nobody fully reads. Here's how I use AI to draft tight custom roles, IAM conditions, and service accounts.Sun, 21 Jun 2026 00:00:00 GMTgcpgcpaiiamleast-privilegesecurityhttps://devopsaitoolkit.com/blog/org-policy-and-security-command-center-triage-with-ai/https://devopsaitoolkit.com/blog/org-policy-and-security-command-center-triage-with-ai/Security Command Center floods you with findings and Org Policy is a maze of constraints. Here's how I use AI to triage SCC findings and write GCP organization policies that hold.Sun, 21 Jun 2026 00:00:00 GMTgcpgcpaisecurityorg-policyscchttps://devopsaitoolkit.com/blog/securing-azure-storage-accounts-with-ai/https://devopsaitoolkit.com/blog/securing-azure-storage-accounts-with-ai/Public blob access, shared keys, and open firewalls are the classic Azure storage leaks. Here's how AI audits storage config, decodes network rules, and drafts the lockdown safely.Sun, 21 Jun 2026 00:00:00 GMTazureazureaistoragesecurityblobhttps://devopsaitoolkit.com/blog/securing-cloud-storage-buckets-with-ai/https://devopsaitoolkit.com/blog/securing-cloud-storage-buckets-with-ai/A misconfigured Cloud Storage bucket is the classic cloud breach. Here's how I use AI to audit GCS IAM, enforce uniform access, and lock down public exposure on GCP.Sun, 21 Jun 2026 00:00:00 GMTgcpgcpaicloud-storagesecuritygcshttps://devopsaitoolkit.com/blog/troubleshooting-aks-with-ai/https://devopsaitoolkit.com/blog/troubleshooting-aks-with-ai/AKS failures hide across kubectl, Azure node pools, and the platform layer. Here's how AI helps you read events, decode CNI errors, and trace a pod failure to its real cause.Sun, 21 Jun 2026 00:00:00 GMTazureazureaiakskubernetestroubleshootinghttps://devopsaitoolkit.com/blog/troubleshooting-eks-with-ai-irsa-networking-and-scheduling/https://devopsaitoolkit.com/blog/troubleshooting-eks-with-ai-irsa-networking-and-scheduling/EKS failures span Kubernetes and AWS at once. Here's how to use AI to triage IRSA, CNI networking, and pod scheduling problems without guessing across layers.Sun, 21 Jun 2026 00:00:00 GMTawsawsaiekskubernetestroubleshootinghttps://devopsaitoolkit.com/blog/troubleshooting-gke-with-ai-workload-identity-networking/https://devopsaitoolkit.com/blog/troubleshooting-gke-with-ai-workload-identity-networking/GKE failures hide across Kubernetes, GCP IAM, and VPC layers at once. Here's how I use AI to untangle Workload Identity errors and pod networking on Google Kubernetes Engine.Sun, 21 Jun 2026 00:00:00 GMTgcpgcpaigkekubernetesnetworkinghttps://devopsaitoolkit.com/blog/tuning-cloud-sql-with-ai/https://devopsaitoolkit.com/blog/tuning-cloud-sql-with-ai/Cloud SQL hides its tuning levers behind flags, insights dashboards, and connection limits. Here's how I use AI to read query insights and tune Postgres and MySQL on GCP.Sun, 21 Jun 2026 00:00:00 GMTgcpgcpaicloud-sqldatabaseperformancehttps://devopsaitoolkit.com/blog/tuning-rds-and-aurora-performance-with-ai/https://devopsaitoolkit.com/blog/tuning-rds-and-aurora-performance-with-ai/Slow queries and mystery CPU spikes on RDS waste hours. Here's how to use AI to read Performance Insights and EXPLAIN plans, then tune without flying blind.Sun, 21 Jun 2026 00:00:00 GMTawsawsairdsauroradatabasehttps://devopsaitoolkit.com/blog/writing-azure-monitor-kql-queries-with-ai/https://devopsaitoolkit.com/blog/writing-azure-monitor-kql-queries-with-ai/KQL is powerful and the schema is huge. Here's how AI drafts Azure Monitor queries fast while you verify the columns, joins, and time grain so your alerts are actually correct.Sun, 21 Jun 2026 00:00:00 GMTazureazureaikqlazure-monitorobservabilityhttps://devopsaitoolkit.com/blog/writing-cloud-monitoring-mql-and-log-queries-with-ai/https://devopsaitoolkit.com/blog/writing-cloud-monitoring-mql-and-log-queries-with-ai/MQL and the Log Explorer query language are powerful and genuinely hard to write from memory. Here's how I use AI to draft GCP monitoring and logging queries that actually run.Sun, 21 Jun 2026 00:00:00 GMTgcpgcpaimonitoringmqllogginghttps://devopsaitoolkit.com/blog/writing-cloudwatch-logs-insights-queries-with-ai/https://devopsaitoolkit.com/blog/writing-cloudwatch-logs-insights-queries-with-ai/The Logs Insights query language is easy to forget under pressure. Here's how to use AI to draft, refine, and verify queries fast during a live incident.Sun, 21 Jun 2026 00:00:00 GMTawsawsaicloudwatchobservabilitylogshttps://devopsaitoolkit.com/blog/writing-least-privilege-iam-policies-with-ai-from-cloudtrail/https://devopsaitoolkit.com/blog/writing-least-privilege-iam-policies-with-ai-from-cloudtrail/Stop shipping iam:* wildcards. Here's how to use CloudTrail and AI to draft least-privilege IAM policies grounded in the calls a role actually makes.Sun, 21 Jun 2026 00:00:00 GMTawsawsaiiamcloudtrailsecurityhttps://devopsaitoolkit.com/blog/ai-assisted-ansible-become-and-connection-debugging/https://devopsaitoolkit.com/blog/ai-assisted-ansible-become-and-connection-debugging/Decode Ansible UNREACHABLE errors, sudo prompts, become_method, ProxyJump, and host key failures faster, with AI drafting fixes while you stay in control.Sat, 20 Jun 2026 00:00:00 GMTansibleansibleaisshprivilege-escalationdebugginghttps://devopsaitoolkit.com/blog/ai-assisted-composite-and-covering-index-design-for-mysql/https://devopsaitoolkit.com/blog/ai-assisted-composite-and-covering-index-design-for-mysql/Most MySQL performance wins come from one right index, not ten wrong ones. Here's how I use AI to design composite and covering indexes and verify them on a replica.Sat, 20 Jun 2026 00:00:00 GMTmysqlmysqlaiindexingperformanceinnodbhttps://devopsaitoolkit.com/blog/ai-assisted-nginx-performance-tuning/https://devopsaitoolkit.com/blog/ai-assisted-nginx-performance-tuning/Use AI to draft and explain NGINX tuning — worker_connections, keepalive, buffers, gzip vs brotli — then measure before and after to keep magic numbers honest.Sat, 20 Jun 2026 00:00:00 GMTnginxnginxaiperformancetuninghttps://devopsaitoolkit.com/blog/ai-assisted-nginx-proxy-caching-and-microcaching/https://devopsaitoolkit.com/blog/ai-assisted-nginx-proxy-caching-and-microcaching/Use AI to draft NGINX proxy_cache and microcaching config, then validate hit rates, cache keys, and stale-while-revalidate yourself with curl and nginx -t.Sat, 20 Jun 2026 00:00:00 GMTnginxnginxaicachingperformancehttps://devopsaitoolkit.com/blog/ai-assisted-nginx-rate-limiting-and-abuse-control/https://devopsaitoolkit.com/blog/ai-assisted-nginx-rate-limiting-and-abuse-control/Use AI to draft and explain NGINX limit_req and limit_conn config, reason about burst sizing, and pick the right key — then validate under real load yourself.Sat, 20 Jun 2026 00:00:00 GMTnginxnginxairate-limitingsecurityhttps://devopsaitoolkit.com/blog/ai-assisted-nginx-reverse-proxy-for-microservices/https://devopsaitoolkit.com/blog/ai-assisted-nginx-reverse-proxy-for-microservices/Route many backend services behind one NGINX with AI: upstream blocks, proxy_set_header, WebSocket upgrades, and the trailing-slash proxy_pass footgun.Sat, 20 Jun 2026 00:00:00 GMTnginxnginxaireverse-proxymicroserviceshttps://devopsaitoolkit.com/blog/ai-assisted-postgres-index-design-and-killing-redundant-indexes/https://devopsaitoolkit.com/blog/ai-assisted-postgres-index-design-and-killing-redundant-indexes/Use AI to propose composite and partial indexes, justify column order, and find redundant or unused indexes in Postgres — then verify every one on a replica.Sat, 20 Jun 2026 00:00:00 GMTpostgrespostgresaiindexingperformancehttps://devopsaitoolkit.com/blog/ai-assisted-review-of-an-ansible-merge-request/https://devopsaitoolkit.com/blog/ai-assisted-review-of-an-ansible-merge-request/Feed the diff to an AI reviewer to catch idempotency regressions, missing no_log, hardcoded values, and become misuse before a human approves the merge.Sat, 20 Jun 2026 00:00:00 GMTansibleansibleaicode-reviewciidempotencyhttps://devopsaitoolkit.com/blog/auditing-ansible-playbooks-for-secret-leaks-with-ai-and-no-log/https://devopsaitoolkit.com/blog/auditing-ansible-playbooks-for-secret-leaks-with-ai-and-no-log/Find where Ansible playbooks leak secrets into logs and verbose output, apply no_log: true correctly, and use AI to flag tasks that need it.Sat, 20 Jun 2026 00:00:00 GMTansibleansibleaisecretssecurityno_loghttps://devopsaitoolkit.com/blog/building-a-searchable-postmortem-knowledge-base-and-trend-report-with-ai/https://devopsaitoolkit.com/blog/building-a-searchable-postmortem-knowledge-base-and-trend-report-with-ai/Postmortems rot in folders nobody searches. Here's how to build a searchable postmortem knowledge base and a quarterly trend report with AI that surfaces real patterns.Sat, 20 Jun 2026 00:00:00 GMTpostmortemspostmortemspostmortemaiknowledge-basetrendshttps://devopsaitoolkit.com/blog/choosing-the-right-postmortem-format-for-the-incident-with-ai/https://devopsaitoolkit.com/blog/choosing-the-right-postmortem-format-for-the-incident-with-ai/Not every incident deserves a five-whys. Here's how to pick narrative, timeline, 5-whys, or contributing-factors postmortems—and how AI drafts the right one fast.Sat, 20 Jun 2026 00:00:00 GMTpostmortemspostmortemspostmortemaitemplatessrehttps://devopsaitoolkit.com/blog/configuring-nginx-ingress-controller-with-ai/https://devopsaitoolkit.com/blog/configuring-nginx-ingress-controller-with-ai/Draft and decode NGINX Ingress manifests with AI: ingressClassName, pathType, cert-manager TLS, and annotations validated with kubectl and the rendered config.Sat, 20 Jun 2026 00:00:00 GMTnginxnginxaikubernetesingresshttps://devopsaitoolkit.com/blog/confirming-the-fix-worked-ai-post-remediation-verification/https://devopsaitoolkit.com/blog/confirming-the-fix-worked-ai-post-remediation-verification/Declaring resolved too early reopens incidents and wrecks MTTR. Use AI to run verify-first post-remediation checks so you close the loop on evidence, not hope.Sat, 20 Jun 2026 00:00:00 GMTreduce-mttrreduce-mttrmttraiverificationsrehttps://devopsaitoolkit.com/blog/counterfactual-analysis-in-postmortems-with-ai-what-would-have-caught-this-sooner/https://devopsaitoolkit.com/blog/counterfactual-analysis-in-postmortems-with-ai-what-would-have-caught-this-sooner/The best postmortem question is 'what would have caught this sooner?' Here's how to run counterfactual analysis with AI to turn incidents into real detection wins.Sat, 20 Jun 2026 00:00:00 GMTpostmortemspostmortemspostmortemaidetectionobservabilityhttps://devopsaitoolkit.com/blog/cutting-time-to-acknowledge-with-ai-alert-enrichment/https://devopsaitoolkit.com/blog/cutting-time-to-acknowledge-with-ai-alert-enrichment/Most TTA is wasted deciding whether an alert is real. AI enrichment puts context on the page so on-call acknowledges in seconds, slashing this slice of MTTR.Sat, 20 Jun 2026 00:00:00 GMTreduce-mttrreduce-mttrmttraialertingon-callhttps://devopsaitoolkit.com/blog/debugging-nginx-502-504-bad-gateway-with-ai/https://devopsaitoolkit.com/blog/debugging-nginx-502-504-bad-gateway-with-ai/Decode NGINX 502 and 504 errors fast: read error.log, diagnose upstream failures and timeouts, and use AI to draft fixes you validate with nginx -t.Sat, 20 Jun 2026 00:00:00 GMTnginxnginxaiupstreamdebuggingtimeoutshttps://devopsaitoolkit.com/blog/debugging-rabbitmq-connection-and-channel-leaks-with-ai/https://devopsaitoolkit.com/blog/debugging-rabbitmq-connection-and-channel-leaks-with-ai/A connection or channel leak creeps up slowly until the broker hits its limit. Here's how to use AI to find the leaking service fast and confirm the fix.Sat, 20 Jun 2026 00:00:00 GMTrabbitmqrabbitmqaiconnectionschannelsdebugginghttps://devopsaitoolkit.com/blog/debugging-slow-mysql-queries-with-ai/https://devopsaitoolkit.com/blog/debugging-slow-mysql-queries-with-ai/The slow query log tells you what hurts, but not why. Here's how I pair the slow log with EXPLAIN and an AI reviewer to find the real fix without guessing.Sat, 20 Jun 2026 00:00:00 GMTmysqlmysqlaiperformanceexplainslow-query-loghttps://devopsaitoolkit.com/blog/debugging-slow-postgres-queries-with-ai/https://devopsaitoolkit.com/blog/debugging-slow-postgres-queries-with-ai/Use AI to decode EXPLAIN (ANALYZE, BUFFERS) output and draft fixes for slow Postgres queries — then verify every change on a replica before it touches prod.Sat, 20 Jun 2026 00:00:00 GMTpostgrespostgresaiperformanceexplainhttps://devopsaitoolkit.com/blog/designing-group-vars-and-host-vars-for-multi-environment-inventories-with-ai/https://devopsaitoolkit.com/blog/designing-group-vars-and-host-vars-for-multi-environment-inventories-with-ai/Use AI to design clean group_vars/host_vars layouts across dev, staging, and prod. Master variable precedence, kill duplication, and keep secrets in vault.Sat, 20 Jun 2026 00:00:00 GMTansibleansibleaiinventoryinfrastructure-as-codevaulthttps://devopsaitoolkit.com/blog/designing-rabbitmq-exchanges-and-routing-with-ai/https://devopsaitoolkit.com/blog/designing-rabbitmq-exchanges-and-routing-with-ai/Topology is the part of RabbitMQ that bites you in production. Here's how to use AI to design exchanges and routing keys, then validate the plan on a staging broker.Sat, 20 Jun 2026 00:00:00 GMTrabbitmqrabbitmqaiexchangesroutingtopologyhttps://devopsaitoolkit.com/blog/diagnosing-mysql-deadlocks-with-ai/https://devopsaitoolkit.com/blog/diagnosing-mysql-deadlocks-with-ai/Deadlock errors look random until you read the InnoDB status. Here's how I use AI to decode the LATEST DETECTED DEADLOCK block and find the real lock-ordering fix.Sat, 20 Jun 2026 00:00:00 GMTmysqlmysqlaiinnodbdeadlockslockinghttps://devopsaitoolkit.com/blog/diagnosing-postgres-lock-contention-and-deadlocks-with-ai/https://devopsaitoolkit.com/blog/diagnosing-postgres-lock-contention-and-deadlocks-with-ai/Use AI to read pg_locks, untangle blocking chains, and decode deadlock logs in Postgres — then fix the access pattern, verified on a replica, not in prod.Sat, 20 Jun 2026 00:00:00 GMTpostgrespostgresailocksconcurrencyhttps://devopsaitoolkit.com/blog/faster-diagnosis-ranked-verify-first-hypotheses-with-ai/https://devopsaitoolkit.com/blog/faster-diagnosis-ranked-verify-first-hypotheses-with-ai/Diagnosis is the fattest slice of MTTR. Learn to use AI for ranked, verify-first hypotheses that speed the team up without anchoring it on the first wrong guess.Sat, 20 Jun 2026 00:00:00 GMTreduce-mttrreduce-mttrmttraidiagnosissrehttps://devopsaitoolkit.com/blog/fixing-rabbitmq-queue-backpressure-and-flow-control-with-ai/https://devopsaitoolkit.com/blog/fixing-rabbitmq-queue-backpressure-and-flow-control-with-ai/When RabbitMQ throttles publishers, the symptoms are confusing and the docs are dense. Here's how to use AI to diagnose backpressure and flow control fast.Sat, 20 Jun 2026 00:00:00 GMTrabbitmqrabbitmqaibackpressureflow-controlperformancehttps://devopsaitoolkit.com/blog/from-postmortem-to-well-scoped-engineering-tickets-with-ai/https://devopsaitoolkit.com/blog/from-postmortem-to-well-scoped-engineering-tickets-with-ai/Postmortem action items die as vague one-liners. Here's how to turn a postmortem into well-scoped Jira or GitHub tickets with AI that actually get picked up and shipped.Sat, 20 Jun 2026 00:00:00 GMTpostmortemspostmortemspostmortemaijiraaction-itemshttps://devopsaitoolkit.com/blog/generating-a-cis-linux-hardening-playbook-with-ai-and-verifying-it/https://devopsaitoolkit.com/blog/generating-a-cis-linux-hardening-playbook-with-ai-and-verifying-it/Use AI to draft a CIS/STIG Ansible hardening playbook for SSH, sysctl, auditd and password policy, then verify it with OpenSCAP before you lock yourself out.Sat, 20 Jun 2026 00:00:00 GMTansibleansibleaicishardeningopenscaphttps://devopsaitoolkit.com/blog/generating-windows-ansible-playbooks-with-ai-safely/https://devopsaitoolkit.com/blog/generating-windows-ansible-playbooks-with-ai-safely/Use AI to draft win_* Ansible plays without smuggling Linux modules into Windows hosts. WinRM setup, win_feature, become, and verifying with win_ping.Sat, 20 Jun 2026 00:00:00 GMTansibleansibleaiwindowswinrmautomationhttps://devopsaitoolkit.com/blog/hardening-nginx-tls-ssl-with-ai/https://devopsaitoolkit.com/blog/hardening-nginx-tls-ssl-with-ai/Use AI to draft NGINX TLS config—ssl_protocols, ssl_ciphers, HSTS, OCSP stapling—then verify every cipher against Mozilla's generator before reload.Sat, 20 Jun 2026 00:00:00 GMTnginxnginxaitlssslsecurityhttps://devopsaitoolkit.com/blog/have-we-seen-this-before-matching-symptoms-to-past-fixes-with-ai/https://devopsaitoolkit.com/blog/have-we-seen-this-before-matching-symptoms-to-past-fixes-with-ai/Re-solving a known incident from scratch wrecks MTTR. Use AI to match live symptoms to past fixes fast, verify-first, so you recall the answer instead of rediscovering it.Sat, 20 Jun 2026 00:00:00 GMTreduce-mttrreduce-mttrmttraiknowledge-basesrehttps://devopsaitoolkit.com/blog/making-flaky-ansible-tasks-reliable-with-ai-retry-until-wait-for/https://devopsaitoolkit.com/blog/making-flaky-ansible-tasks-reliable-with-ai-retry-until-wait-for/Stop papering over flaky Ansible tasks. Use AI to draft the right until/retries and wait_for logic, then verify the condition so retries never hide real bugs.Sat, 20 Jun 2026 00:00:00 GMTansibleansibleairetriesautomationreliabilityhttps://devopsaitoolkit.com/blog/migrating-ansible-modules-to-fqcn-before-a-core-upgrade-with-ai/https://devopsaitoolkit.com/blog/migrating-ansible-modules-to-fqcn-before-a-core-upgrade-with-ai/Use AI to safely migrate short-name Ansible modules to FQCN before an ansible-core upgrade, pin collections, and verify with ansible-lint and syntax-check.Sat, 20 Jun 2026 00:00:00 GMTansibleansibleaifqcnansible-lintautomationhttps://devopsaitoolkit.com/blog/migrating-apache-htaccess-to-nginx-with-ai/https://devopsaitoolkit.com/blog/migrating-apache-htaccess-to-nginx-with-ai/Translate Apache mod_rewrite, RedirectMatch, and AuthType Basic into NGINX with AI, then verify every redirect and run nginx -t before you cut over traffic.Sat, 20 Jun 2026 00:00:00 GMTnginxnginxaiapachemigrationmod_rewritehttps://devopsaitoolkit.com/blog/migrating-mysql-to-utf8mb4-safely-with-ai/https://devopsaitoolkit.com/blog/migrating-mysql-to-utf8mb4-safely-with-ai/MySQL's old 'utf8' can't store emoji and silently truncates. Here's how I use AI to plan a safe utf8mb4 migration and verify nothing breaks on a replica first.Sat, 20 Jun 2026 00:00:00 GMTmysqlmysqlaiutf8mb4charsetmigrationhttps://devopsaitoolkit.com/blog/multi-team-incident-postmortems-untangling-contributing-factors-with-ai/https://devopsaitoolkit.com/blog/multi-team-incident-postmortems-untangling-contributing-factors-with-ai/Cross-team outages produce finger-pointing postmortems. Here's how to untangle contributing factors across service boundaries with AI—and keep the review blameless.Sat, 20 Jun 2026 00:00:00 GMTpostmortemspostmortemspostmortemaicontributing-factorssrehttps://devopsaitoolkit.com/blog/mysql-backup-and-point-in-time-recovery-with-ai/https://devopsaitoolkit.com/blog/mysql-backup-and-point-in-time-recovery-with-ai/A backup you've never restored isn't a backup. Here's how I use AI to plan binlog-based point-in-time recovery and rehearse the restore before I need it.Sat, 20 Jun 2026 00:00:00 GMTmysqlmysqlaibackuprecoverybinloghttps://devopsaitoolkit.com/blog/mysql-replication-setup-and-lag-debugging-with-ai/https://devopsaitoolkit.com/blog/mysql-replication-setup-and-lag-debugging-with-ai/GTID replication is easy to set up and confusing to debug when it breaks. Here's how I use AI to read replica status, find the lagging step, and recover safely.Sat, 20 Jun 2026 00:00:00 GMTmysqlmysqlaireplicationgtidbinloghttps://devopsaitoolkit.com/blog/online-schema-changes-with-gh-ost-and-ai/https://devopsaitoolkit.com/blog/online-schema-changes-with-gh-ost-and-ai/A blocking ALTER on a big table is a self-inflicted outage. Here's how I use AI to plan a safe gh-ost migration and verify the cutover before it touches prod.Sat, 20 Jun 2026 00:00:00 GMTmysqlmysqlaigh-ostmigrationsschemahttps://devopsaitoolkit.com/blog/parallelizing-incident-investigation-with-ai-divide-and-conquer/https://devopsaitoolkit.com/blog/parallelizing-incident-investigation-with-ai-divide-and-conquer/Serial investigation drags out MTTR. Use AI to split an incident into independent, verify-first threads so a small team works in parallel without stepping on each other.Sat, 20 Jun 2026 00:00:00 GMTreduce-mttrreduce-mttrmttraicoordinationon-callhttps://devopsaitoolkit.com/blog/partitioning-large-postgres-tables-with-ai/https://devopsaitoolkit.com/blog/partitioning-large-postgres-tables-with-ai/Use AI to choose a partition key, design range or list partitions, and plan a lock-aware migration of a huge Postgres table — verified on a replica before prod.Sat, 20 Jun 2026 00:00:00 GMTpostgrespostgresaipartitioningscalinghttps://devopsaitoolkit.com/blog/postgres-connection-pooling-with-pgbouncer-and-ai/https://devopsaitoolkit.com/blog/postgres-connection-pooling-with-pgbouncer-and-ai/Use AI to size PgBouncer pools, pick the right pool mode, and debug exhausted Postgres connections — verified with pgbouncer SHOW stats, not guesswork.Sat, 20 Jun 2026 00:00:00 GMTpostgrespostgresaipgbouncerconnectionshttps://devopsaitoolkit.com/blog/postmortem-qa-using-ai-to-catch-missing-sections-and-unsupported-claims/https://devopsaitoolkit.com/blog/postmortem-qa-using-ai-to-catch-missing-sections-and-unsupported-claims/Before a postmortem ships, run QA on it. Here's how AI catches missing sections, unsupported claims, and unaddressed single points of failure—without overruling you.Sat, 20 Jun 2026 00:00:00 GMTpostmortemspostmortemspostmortemaireviewqualityhttps://devopsaitoolkit.com/blog/quantifying-customer-and-business-impact-in-a-postmortem-with-ai/https://devopsaitoolkit.com/blog/quantifying-customer-and-business-impact-in-a-postmortem-with-ai/Vague impact kills postmortem prioritization. Here's how to compute affected users, error-budget burn, SLA credits, and dollars with AI doing the tedious math.Sat, 20 Jun 2026 00:00:00 GMTpostmortemspostmortemspostmortemaislametricshttps://devopsaitoolkit.com/blog/rabbitmq-cross-site-federation-and-shovel-with-ai/https://devopsaitoolkit.com/blog/rabbitmq-cross-site-federation-and-shovel-with-ai/Federation and shovel solve different cross-site problems and people pick wrong. Here's how to use AI to choose and configure them, then verify links on staging.Sat, 20 Jun 2026 00:00:00 GMTrabbitmqrabbitmqaifederationshovelmulti-regionhttps://devopsaitoolkit.com/blog/rabbitmq-dead-letter-queues-and-retry-patterns-with-ai/https://devopsaitoolkit.com/blog/rabbitmq-dead-letter-queues-and-retry-patterns-with-ai/Dead-letter queues are easy to declare and easy to get subtly wrong. Here's how to use AI to design DLX and retry topology, then validate it on staging.Sat, 20 Jun 2026 00:00:00 GMTrabbitmqrabbitmqaidead-letterretryreliabilityhttps://devopsaitoolkit.com/blog/rabbitmq-message-ttl-and-expiration-strategy-with-ai/https://devopsaitoolkit.com/blog/rabbitmq-message-ttl-and-expiration-strategy-with-ai/Message TTL looks simple and behaves in surprising ways. Here's how to use AI to design an expiration strategy that won't silently drop the messages you need.Sat, 20 Jun 2026 00:00:00 GMTrabbitmqrabbitmqaittlexpirationreliabilityhttps://devopsaitoolkit.com/blog/rabbitmq-publisher-confirms-and-idempotent-consumers-with-ai/https://devopsaitoolkit.com/blog/rabbitmq-publisher-confirms-and-idempotent-consumers-with-ai/Zero message loss takes publisher confirms on one end and idempotent consumers on the other. Here's how to use AI to design both and prove them on staging.Sat, 20 Jun 2026 00:00:00 GMTrabbitmqrabbitmqaipublisher-confirmsidempotencyreliabilityhttps://devopsaitoolkit.com/blog/rabbitmq-quorum-queues-vs-classic-mirrored-queues-with-ai/https://devopsaitoolkit.com/blog/rabbitmq-quorum-queues-vs-classic-mirrored-queues-with-ai/Mirrored queues are deprecated and quorum queues are the path forward — but migrating isn't free. Here's how to use AI to reason through the trade-offs safely.Sat, 20 Jun 2026 00:00:00 GMTrabbitmqrabbitmqaiquorum-queueshamigrationhttps://devopsaitoolkit.com/blog/reviewing-ansible-check-and-diff-dry-runs-with-ai-before-prod/https://devopsaitoolkit.com/blog/reviewing-ansible-check-and-diff-dry-runs-with-ai-before-prod/Read ansible-playbook --check --diff output properly: know which modules lie in check mode, tame diff noise, and use AI to summarize what will actually change.Sat, 20 Jun 2026 00:00:00 GMTansibleansibleaicheck-modedry-runproductionhttps://devopsaitoolkit.com/blog/sanitizing-a-postmortem-for-public-or-cross-customer-sharing-with-ai/https://devopsaitoolkit.com/blog/sanitizing-a-postmortem-for-public-or-cross-customer-sharing-with-ai/Sharing a postmortem externally without leaking secrets is fiddly. Here's how to anonymize and sanitize a postmortem with AI while keeping the lessons intact.Sat, 20 Jun 2026 00:00:00 GMTpostmortemspostmortemspostmortemaisecuritycommunicationhttps://devopsaitoolkit.com/blog/setting-up-and-debugging-postgres-replication-with-ai/https://devopsaitoolkit.com/blog/setting-up-and-debugging-postgres-replication-with-ai/Use AI to stand up streaming and logical replication, read replication lag and slot stats, and debug a stuck Postgres replica — verified on the catalog, not guesses.Sat, 20 Jun 2026 00:00:00 GMTpostgrespostgresaireplicationhigh-availabilityhttps://devopsaitoolkit.com/blog/surfacing-the-right-runbook-and-next-command-with-ai/https://devopsaitoolkit.com/blog/surfacing-the-right-runbook-and-next-command-with-ai/Knowing the cause but hunting for the runbook wastes MTTR. Use AI to surface the right runbook and the exact next command, verify-first, so mitigation starts fast.Sat, 20 Jun 2026 00:00:00 GMTreduce-mttrreduce-mttrmttrairunbookson-callhttps://devopsaitoolkit.com/blog/taming-postgres-bloat-and-autovacuum-with-ai/https://devopsaitoolkit.com/blog/taming-postgres-bloat-and-autovacuum-with-ai/Use AI to read autovacuum stats, size table and index bloat, and tune autovacuum thresholds for hot Postgres tables — verified against the catalog, not vibes.Sat, 20 Jun 2026 00:00:00 GMTpostgrespostgresaiautovacuumbloathttps://devopsaitoolkit.com/blog/the-ai-incident-scribe-a-live-timeline-that-survives-handoffs/https://devopsaitoolkit.com/blog/the-ai-incident-scribe-a-live-timeline-that-survives-handoffs/Handoffs leak context and inflate MTTR. An AI scribe keeps a live, verify-first incident timeline so the next responder ramps in minutes, not from scratch.Sat, 20 Jun 2026 00:00:00 GMTreduce-mttrreduce-mttrmttraiincident-timelineon-callhttps://devopsaitoolkit.com/blog/the-first-five-minutes-ai-assisted-incident-triage/https://devopsaitoolkit.com/blog/the-first-five-minutes-ai-assisted-incident-triage/Severity, blast radius, ownership — the first five minutes set your MTTR. See how AI assembles the triage picture fast so you classify and route without flailing.Sat, 20 Jun 2026 00:00:00 GMTreduce-mttrreduce-mttrmttraitriageon-callhttps://devopsaitoolkit.com/blog/the-mttr-retro-using-ai-to-kill-recurring-time-sinks/https://devopsaitoolkit.com/blog/the-mttr-retro-using-ai-to-kill-recurring-time-sinks/Your MTTR is dragged down by the same time-sinks every incident. Use AI to mine your retros, find the recurring drains, and kill them — verify-first, not vibes.Sat, 20 Jun 2026 00:00:00 GMTreduce-mttrreduce-mttrmttrairetrospectivesrehttps://devopsaitoolkit.com/blog/tuning-innodb-buffer-pool-and-flushing-with-ai/https://devopsaitoolkit.com/blog/tuning-innodb-buffer-pool-and-flushing-with-ai/InnoDB's buffer pool and flushing settings decide whether your database flies or thrashes. Here's how I use AI to read the metrics and tune them without cargo-culting.Sat, 20 Jun 2026 00:00:00 GMTmysqlmysqlaiinnodbtuningbuffer-poolhttps://devopsaitoolkit.com/blog/tuning-my-cnf-for-your-workload-with-ai/https://devopsaitoolkit.com/blog/tuning-my-cnf-for-your-workload-with-ai/Copy-pasted my.cnf templates ignore your actual workload. Here's how I use AI to read my status counters and tune the config to what the database is really doing.Sat, 20 Jun 2026 00:00:00 GMTmysqlmysqlaiconfigurationtuningmy-cnfhttps://devopsaitoolkit.com/blog/tuning-postgresql-conf-for-your-workload-with-ai/https://devopsaitoolkit.com/blog/tuning-postgresql-conf-for-your-workload-with-ai/Use AI to reason about shared_buffers, work_mem, WAL and planner settings for your actual Postgres workload — then verify every change with measurements, not defaults.Sat, 20 Jun 2026 00:00:00 GMTpostgrespostgresaituningconfigurationhttps://devopsaitoolkit.com/blog/tuning-rabbitmq-consumer-prefetch-qos-with-ai/https://devopsaitoolkit.com/blog/tuning-rabbitmq-consumer-prefetch-qos-with-ai/Prefetch is the single highest-leverage RabbitMQ knob and the easiest to set wrong. Here's how to use AI to reason about QoS, then verify the number on staging.Sat, 20 Jun 2026 00:00:00 GMTrabbitmqrabbitmqaiprefetchqosperformancehttps://devopsaitoolkit.com/blog/understanding-nginx-location-block-precedence-with-ai/https://devopsaitoolkit.com/blog/understanding-nginx-location-block-precedence-with-ai/Decode NGINX location and regex precedence with AI: exact, prefix, ^~, ~ and ~* order, why a URI hits the wrong block, and try_files, validated by nginx -t.Sat, 20 Jun 2026 00:00:00 GMTnginxnginxairoutingregexhttps://devopsaitoolkit.com/blog/writing-the-what-went-well-section-of-a-postmortem-with-ai/https://devopsaitoolkit.com/blog/writing-the-what-went-well-section-of-a-postmortem-with-ai/Postmortems that are only failure lists teach teams to hide. Here's how to write an honest what-went-well section, with AI surfacing the saves from the timeline.Sat, 20 Jun 2026 00:00:00 GMTpostmortemspostmortemspostmortemaiblamelessculturehttps://devopsaitoolkit.com/blog/zero-downtime-lock-aware-postgres-migrations-with-ai/https://devopsaitoolkit.com/blog/zero-downtime-lock-aware-postgres-migrations-with-ai/Use AI to review Postgres migrations for dangerous locks and draft safe multi-step rollouts — NOT NULL, new columns, type changes — verified on a replica first.Sat, 20 Jun 2026 00:00:00 GMTpostgrespostgresaimigrationsschemahttps://devopsaitoolkit.com/blog/adaptive-card-input-validation-for-self-service-forms/https://devopsaitoolkit.com/blog/adaptive-card-input-validation-for-self-service-forms/Bad input breaks self-service ops bots. Adaptive Cards have built-in client-side validation for inputs — here is how to use it well and still validate on the server.Thu, 18 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsadaptive-cardsvalidationself-servicejsonhttps://devopsaitoolkit.com/blog/adaptive-card-table-layouts-for-teams-dashboards/https://devopsaitoolkit.com/blog/adaptive-card-table-layouts-for-teams-dashboards/FactSets fall apart for tabular data. Adaptive Cards 1.5+ has a real Table element with columns and cells — here is how to render dense ops data cleanly in Teams.Thu, 18 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsadaptive-cardstablesdashboardsjsonhttps://devopsaitoolkit.com/blog/ai-assisted-csv-and-spreadsheet-wrangling-in-python/https://devopsaitoolkit.com/blog/ai-assisted-csv-and-spreadsheet-wrangling-in-python/Ops lives on CSV exports nobody wants to touch. Use AI to draft Python that cleans, joins, and reports — then verify the numbers before anyone trusts them.Thu, 18 Jun 2026 00:00:00 GMTbash-python-automationbashpythoncsvpandasautomationhttps://devopsaitoolkit.com/blog/ai-assisted-gitlab-ci-runner-tag-and-resource-tuning/https://devopsaitoolkit.com/blog/ai-assisted-gitlab-ci-runner-tag-and-resource-tuning/Use AI to right-size GitLab runner tags, Kubernetes resource requests, and job placement so you cut both cloud spend and CI queue time without guesswork.Thu, 18 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdairunnerscost-optimizationhttps://devopsaitoolkit.com/blog/ai-assisted-jira-ticket-triage-and-routing-automation/https://devopsaitoolkit.com/blog/ai-assisted-jira-ticket-triage-and-routing-automation/Use AI to classify, label, and route incoming Jira tickets to the right team with structured JSON, a confidence threshold, and a human approving every move.Thu, 18 Jun 2026 00:00:00 GMTautomationautomationjiratriageaihttps://devopsaitoolkit.com/blog/ai-assisted-log-based-alert-rule-generation/https://devopsaitoolkit.com/blog/ai-assisted-log-based-alert-rule-generation/Turn recurring log patterns into tested Prometheus and Loki alert rules with AI as a drafting aid, while review, promtool tests, and a back-out path gate paging.Thu, 18 Jun 2026 00:00:00 GMTautomationautomationalertingobservabilityaihttps://devopsaitoolkit.com/blog/ai-assisted-on-call-shift-handoff-summaries/https://devopsaitoolkit.com/blog/ai-assisted-on-call-shift-handoff-summaries/The worst incidents are the ones that fall through the cracks between shifts. Here's how to use AI to draft on-call handoff summaries so nothing gets dropped.Thu, 18 Jun 2026 00:00:00 GMTincident-responseincident-responseaion-calloperationssrehttps://devopsaitoolkit.com/blog/ai-assisted-pre-commit-hooks-for-automation-repos/https://devopsaitoolkit.com/blog/ai-assisted-pre-commit-hooks-for-automation-repos/Use AI like a fast junior engineer to build and refine pre-commit hooks that catch automation script bugs, leaked secrets, and bad config before they ever land.Thu, 18 Jun 2026 00:00:00 GMTautomationautomationpre-commitgitcihttps://devopsaitoolkit.com/blog/ai-assisted-regex-for-ops-without-the-headaches/https://devopsaitoolkit.com/blog/ai-assisted-regex-for-ops-without-the-headaches/Regex is write-once, debug-forever. Use AI to draft and explain patterns for logs and configs, then test against real strings before any pattern ships.Thu, 18 Jun 2026 00:00:00 GMTbash-python-automationbashpythonregexlogsautomationhttps://devopsaitoolkit.com/blog/ai-assisted-sed-and-awk-for-log-and-config-munging/https://devopsaitoolkit.com/blog/ai-assisted-sed-and-awk-for-log-and-config-munging/sed and awk are unbeatable for text munging but nobody remembers the syntax. Use AI to draft the one-liner, then verify it against real data before prod.Thu, 18 Jun 2026 00:00:00 GMTbash-python-automationbashpythonsedawkautomationhttps://devopsaitoolkit.com/blog/ai-assisted-slack-bot-localization-for-global-teams/https://devopsaitoolkit.com/blog/ai-assisted-slack-bot-localization-for-global-teams/Use AI to localize Slack bot messages and Block Kit for global teams, keyed by user locale. Review translations, verify webhooks, keep tokens out of the model.Thu, 18 Jun 2026 00:00:00 GMTslackslackchatopsailocalizationhttps://devopsaitoolkit.com/blog/ai-debugging-prometheus-relabeling-dropped-targets/https://devopsaitoolkit.com/blog/ai-debugging-prometheus-relabeling-dropped-targets/AI is great at reasoning through relabel_configs, but it can't see your live targets. How I use it to debug dropped Prometheus scrape targets safely.Thu, 18 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusrelabelingaiservice-discoverysrehttps://devopsaitoolkit.com/blog/ai-drafted-customer-status-updates-from-slack-incidents/https://devopsaitoolkit.com/blog/ai-drafted-customer-status-updates-from-slack-incidents/Use AI to turn internal Slack incident chatter into clear, public status-page updates. Bolt, Block Kit, signed events, and mandatory human approval before posting.Thu, 18 Jun 2026 00:00:00 GMTslackslackchatopsaiincidentshttps://devopsaitoolkit.com/blog/ai-drafted-gitlab-ci-merge-request-and-codeowners-governance/https://devopsaitoolkit.com/blog/ai-drafted-gitlab-ci-merge-request-and-codeowners-governance/Use AI to draft GitLab MR templates, CODEOWNERS path rules, and approval policies that CI actually enforces — so risky paths never merge unreviewed again.Thu, 18 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdaicodeownersmerge-requestshttps://devopsaitoolkit.com/blog/ai-generated-grafana-alert-rules-review/https://devopsaitoolkit.com/blog/ai-generated-grafana-alert-rules-review/Grafana's unified alerting hides real complexity behind a friendly UI. How I review AI-generated Grafana alert rules so they don't fire wrong or stay silent.Thu, 18 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusgrafanaalertingaisrehttps://devopsaitoolkit.com/blog/ai-generated-rollback-jobs-for-gitlab-deployments/https://devopsaitoolkit.com/blog/ai-generated-rollback-jobs-for-gitlab-deployments/Use AI to draft safe, manual-gated rollback jobs in GitLab CI for Kubernetes and Helm deployments, scaffolded from your deploy config and reviewed first.Thu, 18 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdaideploymentrollbackhttps://devopsaitoolkit.com/blog/ai-generated-slack-changelog-bot-from-merged-prs/https://devopsaitoolkit.com/blog/ai-generated-slack-changelog-bot-from-merged-prs/Use AI to turn merged pull requests into a human-readable changelog and post it to Slack with Bolt and Block Kit. Verify webhooks, review before shipping.Thu, 18 Jun 2026 00:00:00 GMTslackslackchatopsaichangeloghttps://devopsaitoolkit.com/blog/ai-generated-slo-error-budget-reports-in-slack/https://devopsaitoolkit.com/blog/ai-generated-slo-error-budget-reports-in-slack/Turn SLO metrics into plain-language error-budget reports in Slack with AI. Bolt, Block Kit, signed interactions, and a human read before the team sees it.Thu, 18 Jun 2026 00:00:00 GMTslackslackchatopsaisrehttps://devopsaitoolkit.com/blog/ai-generated-test-cases-for-slack-bot-handlers/https://devopsaitoolkit.com/blog/ai-generated-test-cases-for-slack-bot-handlers/Use AI to generate realistic test cases for Slack Bolt handlers, including signed payloads and edge cases. Review every test before trusting it in CI.Thu, 18 Jun 2026 00:00:00 GMTslackslackchatopsaitestinghttps://devopsaitoolkit.com/blog/ai-instrumentation-review-labels-before-they-explode/https://devopsaitoolkit.com/blog/ai-instrumentation-review-labels-before-they-explode/Cardinality bombs are born in application code, not Prometheus. How I use AI to review instrumentation before high-cardinality labels ever reach the TSDB.Thu, 18 Jun 2026 00:00:00 GMTprometheus-monitoringprometheuscardinalityinstrumentationaicode-reviewhttps://devopsaitoolkit.com/blog/ai-onboarding-buddy-bot-for-new-engineers-in-slack/https://devopsaitoolkit.com/blog/ai-onboarding-buddy-bot-for-new-engineers-in-slack/Create a Slack onboarding bot that guides new engineers with AI-tailored steps, App Home checklists, and signed events. Human review before it greets anyone.Thu, 18 Jun 2026 00:00:00 GMTslackslackchatopsaionboardinghttps://devopsaitoolkit.com/blog/ai-powered-slack-faq-bot-for-internal-engineering-docs/https://devopsaitoolkit.com/blog/ai-powered-slack-faq-bot-for-internal-engineering-docs/Wire an AI FAQ bot into Slack that answers questions from your internal docs with citations. Bolt, app_mention events, signature checks, human review.Thu, 18 Jun 2026 00:00:00 GMTslackslackchatopsaidocumentationhttps://devopsaitoolkit.com/blog/ai-sre-agents-compared/https://devopsaitoolkit.com/blog/ai-sre-agents-compared/An honest comparison of AI SRE agents — Datadog Bits AI, PagerDuty SRE Agent, Amazon Q, Copilot for Azure, K8sGPT — by autonomy, grounding, remediation safety, and cost.Thu, 18 Jun 2026 00:00:00 GMTincident-responseai-sreincident-responseagentic-aisreobservabilityhttps://devopsaitoolkit.com/blog/ai-summarized-cloud-cost-alerts-in-slack/https://devopsaitoolkit.com/blog/ai-summarized-cloud-cost-alerts-in-slack/Turn raw cloud billing data into plain-language cost alerts in Slack with AI. Bolt, Block Kit, signed webhooks, and a human check before anyone panics.Thu, 18 Jun 2026 00:00:00 GMTslackslackchatopsaifinopshttps://devopsaitoolkit.com/blog/ai-triaged-customer-feedback-routing-to-slack-channels/https://devopsaitoolkit.com/blog/ai-triaged-customer-feedback-routing-to-slack-channels/Use AI to classify incoming customer feedback and route it to the right Slack channel with Bolt and Block Kit. Verify webhooks, human review on edge cases.Thu, 18 Jun 2026 00:00:00 GMTslackslackchatopsaitriagehttps://devopsaitoolkit.com/blog/ai-workflows-for-kubernetes-cluster-troubleshooting/https://devopsaitoolkit.com/blog/ai-workflows-for-kubernetes-cluster-troubleshooting/How AI workflows detect, diagnose, and safely remediate Kubernetes failures — the tools, the safety layers, a production rollout plan, and what AI can't fix.Thu, 18 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesaitroubleshootingsreautomationhttps://devopsaitoolkit.com/blog/analyzing-terraform-plan-blast-radius-with-ai/https://devopsaitoolkit.com/blog/analyzing-terraform-plan-blast-radius-with-ai/A plan that destroys and recreates a database reads almost the same as one that tweaks a tag. AI can surface the blast radius hiding in your plan JSON.Thu, 18 Jun 2026 00:00:00 GMTterraformterraformaiplanreviewsafetyhttps://devopsaitoolkit.com/blog/ansible-network-automation-for-switches-and-routers-with-ai/https://devopsaitoolkit.com/blog/ansible-network-automation-for-switches-and-routers-with-ai/Automate Cisco IOS, Arista EOS, and Juniper config with Ansible and network_cli. Resource modules, backups, check-mode dry runs, and where AI helps.Thu, 18 Jun 2026 00:00:00 GMTansibleiacansiblenetworkingciscoaihttps://devopsaitoolkit.com/blog/at-mention-on-call-engineers-in-teams-adaptive-cards/https://devopsaitoolkit.com/blog/at-mention-on-call-engineers-in-teams-adaptive-cards/A card nobody is pinged about gets ignored. Learn how to render real @-mentions inside Adaptive Cards so the right on-call engineer actually gets notified.Thu, 18 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsadaptive-cardsmentionson-callalertinghttps://devopsaitoolkit.com/blog/auditing-cors-configuration-with-ai/https://devopsaitoolkit.com/blog/auditing-cors-configuration-with-ai/A wildcard origin with credentials is an open door. Here's how I use AI to audit CORS policies for reflected origins, credential leaks, and over-broad allowlists.Thu, 18 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningcorsapiaihttps://devopsaitoolkit.com/blog/automating-database-schema-migrations-safely-with-ai/https://devopsaitoolkit.com/blog/automating-database-schema-migrations-safely-with-ai/Use AI to draft, review, and gate database schema migrations so they roll forward and back cleanly, never lock prod, and always keep a human-owned back-out path.Thu, 18 Jun 2026 00:00:00 GMTautomationautomationdatabasemigrationscihttps://devopsaitoolkit.com/blog/automating-feature-flag-cleanup-with-ai/https://devopsaitoolkit.com/blog/automating-feature-flag-cleanup-with-ai/Use AI to surface stale feature flags, generate cleanup PRs, and retire dead toggles safely. Find last-evaluated dates and collapse dead branches with review.Thu, 18 Jun 2026 00:00:00 GMTautomationautomationfeature-flagstech-debtaihttps://devopsaitoolkit.com/blog/automating-stale-branch-and-pr-cleanup-with-ai-guardrails/https://devopsaitoolkit.com/blog/automating-stale-branch-and-pr-cleanup-with-ai-guardrails/Use AI and the GitHub API to find, summarize, and safely retire stale branches and abandoned pull requests with notify-then-wait grace periods and human gates.Thu, 18 Jun 2026 00:00:00 GMTautomationautomationgithubgitcleanuphttps://devopsaitoolkit.com/blog/automating-workflows-with-openstack-mistral/https://devopsaitoolkit.com/blog/automating-workflows-with-openstack-mistral/Mistral turns multi-step OpenStack operations into versioned, retryable workflows. Here is how I author, debug, and run them — with an AI pairing as my fast junior engineer.Thu, 18 Jun 2026 00:00:00 GMTopenstackopenstackmistralworkflowautomationdevopshttps://devopsaitoolkit.com/blog/backup-as-a-service-with-openstack-freezer/https://devopsaitoolkit.com/blog/backup-as-a-service-with-openstack-freezer/Freezer brings scheduled, multi-tenant backup and restore to OpenStack. Here is how I configure jobs, run restores, and use AI to draft the parts I dare not get wrong.Thu, 18 Jun 2026 00:00:00 GMTopenstackopenstackfreezerbackupdisaster-recoverydevopshttps://devopsaitoolkit.com/blog/building-a-python-slack-bot-for-ops-with-ai/https://devopsaitoolkit.com/blog/building-a-python-slack-bot-for-ops-with-ai/A Slack bot turns your runbooks into chat commands. Use AI to draft the Bolt handlers, then lock down auth, verify signatures, and keep tokens out of code.Thu, 18 Jun 2026 00:00:00 GMTbash-python-automationbashpythonslackchatopsautomationhttps://devopsaitoolkit.com/blog/building-a-safe-bulk-resource-tagging-workflow-with-ai/https://devopsaitoolkit.com/blog/building-a-safe-bulk-resource-tagging-workflow-with-ai/Use AI to audit untagged cloud resources and apply a bulk tagging workflow with dry-runs, least-privilege roles, and human approval before any write lands.Thu, 18 Jun 2026 00:00:00 GMTautomationautomationcloudtaggingfinopshttps://devopsaitoolkit.com/blog/building-a-terraform-pr-review-bot-with-ai/https://devopsaitoolkit.com/blog/building-a-terraform-pr-review-bot-with-ai/Wire an AI reviewer into Terraform pull requests so it comments on every plan automatically — with an architecture that gives it zero ability to apply anything.Thu, 18 Jun 2026 00:00:00 GMTterraformterraformaici-cdautomationreviewhttps://devopsaitoolkit.com/blog/building-incident-timelines-from-prometheus-with-ai/https://devopsaitoolkit.com/blog/building-incident-timelines-from-prometheus-with-ai/AI can assemble a postmortem timeline from Prometheus metrics in minutes, but it can also invent causality. How I build accurate, evidence-backed timelines.Thu, 18 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusincident-responsepostmortemaisrehttps://devopsaitoolkit.com/blog/building-rollback-decision-criteria-with-ai/https://devopsaitoolkit.com/blog/building-rollback-decision-criteria-with-ai/Deciding whether to roll back mid-incident is high stakes and high stress. Here's how to use AI to draft clear rollback criteria ahead of time so the call is faster.Thu, 18 Jun 2026 00:00:00 GMTincident-responseincident-responseaideploymentrunbookssrehttps://devopsaitoolkit.com/blog/catching-promql-unit-mistakes-with-ai/https://devopsaitoolkit.com/blog/catching-promql-unit-mistakes-with-ai/Bytes vs bits, seconds vs milliseconds, ratios vs percentages — PromQL unit bugs are silent and dangerous. How I use AI to catch them before they ship.Thu, 18 Jun 2026 00:00:00 GMTprometheus-monitoringprometheuspromqlaicode-reviewsrehttps://devopsaitoolkit.com/blog/chargeback-and-rating-with-openstack-cloudkitty/https://devopsaitoolkit.com/blog/chargeback-and-rating-with-openstack-cloudkitty/CloudKitty turns OpenStack usage into invoices and showback reports. Here is how I configure rating rules, debug missing data, and let AI draft the tricky parts.Thu, 18 Jun 2026 00:00:00 GMTopenstackopenstackcloudkittybillingchargebackdevopshttps://devopsaitoolkit.com/blog/conditional-and-localized-content-in-teams-adaptive-cards/https://devopsaitoolkit.com/blog/conditional-and-localized-content-in-teams-adaptive-cards/One card, many audiences. Use toggleVisibility, $when templating, and host config to show the right content per role and language without building five cards.Thu, 18 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsadaptive-cardstemplatinglocalizationjsonhttps://devopsaitoolkit.com/blog/converting-cloudformation-to-terraform-with-ai/https://devopsaitoolkit.com/blog/converting-cloudformation-to-terraform-with-ai/AI can translate CloudFormation YAML into HCL faster than any human, but the output lies in subtle ways. Here's a workflow that catches the lies before they ship.Thu, 18 Jun 2026 00:00:00 GMTterraformterraformaicloudformationmigrationawshttps://devopsaitoolkit.com/blog/converting-kubernetes-manifests-to-a-helm-chart-with-ai/https://devopsaitoolkit.com/blog/converting-kubernetes-manifests-to-a-helm-chart-with-ai/Got a folder of plain YAML you redeploy by hand? Use AI to templatize it into a parameterized Helm chart, then verify the render matches the originals.Thu, 18 Jun 2026 00:00:00 GMTkubernetes-helmkuberneteshelmtemplatingaihttps://devopsaitoolkit.com/blog/customizing-and-debugging-openstack-horizon/https://devopsaitoolkit.com/blog/customizing-and-debugging-openstack-horizon/Horizon is the dashboard your users actually see. Here is how I customize it, debug the blank-page failures, and use AI to navigate its Django internals safely.Thu, 18 Jun 2026 00:00:00 GMTopenstackopenstackhorizondashboarddjangodevopshttps://devopsaitoolkit.com/blog/debugging-ansible-variable-precedence-with-ai/https://devopsaitoolkit.com/blog/debugging-ansible-variable-precedence-with-ai/Untangle Ansible's 22-level variable precedence with AI. Map where a var is defined, see which value wins, and fix silent group_vars and role override bugs fast.Thu, 18 Jun 2026 00:00:00 GMTansibleiacansibledebuggingai-assistedhttps://devopsaitoolkit.com/blog/debugging-helm-template-rendering-errors-with-ai/https://devopsaitoolkit.com/blog/debugging-helm-template-rendering-errors-with-ai/Helm template errors are cryptic by design. Here is how to use AI to decode nil-pointer panics, range failures, and indentation bugs in your chart templates.Thu, 18 Jun 2026 00:00:00 GMTkubernetes-helmkuberneteshelmtemplatingdebugginghttps://devopsaitoolkit.com/blog/decoding-openssl-commands-on-linux-with-ai/https://devopsaitoolkit.com/blog/decoding-openssl-commands-on-linux-with-ai/The openssl CLI has 50 subcommands and a man page from another era. Here's how to inspect certs, debug TLS handshakes, and let AI translate the cryptic flags.Thu, 18 Jun 2026 00:00:00 GMTlinux-adminslinuxopenssltlscertificatessecurityhttps://devopsaitoolkit.com/blog/deduplicating-alert-storms-with-ai/https://devopsaitoolkit.com/blog/deduplicating-alert-storms-with-ai/When 200 alerts fire in two minutes, the signal drowns. Here's how to use AI to collapse an alert storm into a handful of likely root causes without losing the real one.Thu, 18 Jun 2026 00:00:00 GMTincident-responseincident-responseaialertingobservabilitysrehttps://devopsaitoolkit.com/blog/deploying-the-skyline-dashboard-for-openstack/https://devopsaitoolkit.com/blog/deploying-the-skyline-dashboard-for-openstack/Skyline is OpenStack's modern, faster alternative to Horizon. Here is how I deploy it, wire it to Keystone, debug the gateway, and let AI handle the config grind.Thu, 18 Jun 2026 00:00:00 GMTopenstackopenstackskylinedashboarddeploymentdevopshttps://devopsaitoolkit.com/blog/designing-node-affinity-taints-and-tolerations-with-ai/https://devopsaitoolkit.com/blog/designing-node-affinity-taints-and-tolerations-with-ai/Scheduling rules are where Kubernetes config gets subtle. Use AI to draft node affinity, taints, and tolerations and to explain why pods land where they do.Thu, 18 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesschedulingnode-affinityaihttps://devopsaitoolkit.com/blog/dry-running-destructive-scripts-with-ai-before-prod/https://devopsaitoolkit.com/blog/dry-running-destructive-scripts-with-ai-before-prod/Destructive automation deserves a dry-run mode. Use AI to add --dry-run, preview diffs, and confirmation gates so a script shows its work before it acts.Thu, 18 Jun 2026 00:00:00 GMTbash-python-automationbashpythonsafetydry-runautomationhttps://devopsaitoolkit.com/blog/endpoint-visibility-with-osquery-and-ai-triage/https://devopsaitoolkit.com/blog/endpoint-visibility-with-osquery-and-ai-triage/osquery turns your fleet into a database you can ask questions of. Here's how I use AI to write defensive detection queries and triage the results without drowning in rows.Thu, 18 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningosquerydetectionaihttps://devopsaitoolkit.com/blog/enriching-alert-annotations-with-live-promql-context/https://devopsaitoolkit.com/blog/enriching-alert-annotations-with-live-promql-context/An alert that says only what fired wastes on-call time. How I use AI to write annotation templates that pull live PromQL context into every page.Thu, 18 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusalertingannotationsaisrehttps://devopsaitoolkit.com/blog/estimating-incident-cost-financial-impact-with-ai/https://devopsaitoolkit.com/blog/estimating-incident-cost-financial-impact-with-ai/Leadership always asks what an outage cost. Here's how to use AI to draft a defensible financial impact estimate fast, without inventing numbers you can't back up.Thu, 18 Jun 2026 00:00:00 GMTincident-responseincident-responseaimetricsfinancesrehttps://devopsaitoolkit.com/blog/generating-blackbox-probe-configs-with-ai/https://devopsaitoolkit.com/blog/generating-blackbox-probe-configs-with-ai/The Prometheus blackbox exporter is fiddly YAML that AI writes fast. How I generate probe modules and scrape configs without shipping false-green checks.Thu, 18 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusblackbox-exportermonitoringaiyamlhttps://devopsaitoolkit.com/blog/generating-game-day-chaos-scenarios-with-ai/https://devopsaitoolkit.com/blog/generating-game-day-chaos-scenarios-with-ai/Game days only build skill if the scenarios are realistic and varied. Here's how to use AI to generate chaos scenarios that stretch your team without trusting it to inject faults.Thu, 18 Jun 2026 00:00:00 GMTincident-responseincident-responseaichaos-engineeringgame-daysrehttps://devopsaitoolkit.com/blog/generating-helm-values-schema-json-with-ai/https://devopsaitoolkit.com/blog/generating-helm-values-schema-json-with-ai/Use AI to draft a JSON Schema for your Helm chart values so bad config fails at install time instead of three minutes into a broken rollout.Thu, 18 Jun 2026 00:00:00 GMTkubernetes-helmkuberneteshelmjson-schemaaihttps://devopsaitoolkit.com/blog/generating-makefiles-and-justfiles-for-repeatable-ops-tasks/https://devopsaitoolkit.com/blog/generating-makefiles-and-justfiles-for-repeatable-ops-tasks/Use AI to turn ad-hoc shell commands into clean Makefile and justfile task runners your whole team can run safely, with guard prompts and back-out paths.Thu, 18 Jun 2026 00:00:00 GMTautomationautomationmakejusttoolinghttps://devopsaitoolkit.com/blog/generating-makefiles-for-ops-task-runners-with-ai/https://devopsaitoolkit.com/blog/generating-makefiles-for-ops-task-runners-with-ai/A Makefile is the simplest task runner that's already installed everywhere. Use AI to draft self-documenting targets, then review for the classic make footguns.Thu, 18 Jun 2026 00:00:00 GMTbash-python-automationbashpythonmakeautomationhttps://devopsaitoolkit.com/blog/generating-network-policies-from-observed-traffic-with-ai/https://devopsaitoolkit.com/blog/generating-network-policies-from-observed-traffic-with-ai/Stop guessing at NetworkPolicy rules. Capture real flow data, hand it to AI, and review a least-privilege policy you can actually trust before applying it.Thu, 18 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesnetwork-policysecurityaihttps://devopsaitoolkit.com/blog/generating-terraform-documentation-with-ai-and-terraform-docs/https://devopsaitoolkit.com/blog/generating-terraform-documentation-with-ai-and-terraform-docs/terraform-docs gives you the tables; AI writes the prose nobody wants to. Pair them to ship module docs that explain the why, not just the variable names.Thu, 18 Jun 2026 00:00:00 GMTterraformterraformaidocumentationmodulesterraform-docshttps://devopsaitoolkit.com/blog/govern-teams-app-permission-and-setup-policies-with-graph/https://devopsaitoolkit.com/blog/govern-teams-app-permission-and-setup-policies-with-graph/Control which Teams apps users can install and what gets pinned, at scale, through Graph. A practical guide to app permission and setup policies for DevOps.Thu, 18 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsmicrosoft-graphgovernancepolicysecurityhttps://devopsaitoolkit.com/blog/hardening-jwt-validation-with-ai-review/https://devopsaitoolkit.com/blog/hardening-jwt-validation-with-ai-review/JWTs fail open in quiet ways. Here's how I use AI as a fast junior reviewer to catch alg confusion, skipped signature checks, and missing claim validation before they ship.Thu, 18 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningjwtauthenticationaihttps://devopsaitoolkit.com/blog/hardening-rate-limiting-and-abuse-controls-with-ai/https://devopsaitoolkit.com/blog/hardening-rate-limiting-and-abuse-controls-with-ai/Credential stuffing and enumeration don't trip a WAF. Here's how I use AI to design and audit application-layer rate limits and abuse controls that actually slow attackers.Thu, 18 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningrate-limitingabuseaihttps://devopsaitoolkit.com/blog/instrumenting-gitlab-pipelines-with-ai-generated-otel-traces/https://devopsaitoolkit.com/blog/instrumenting-gitlab-pipelines-with-ai-generated-otel-traces/Use AI to scaffold OpenTelemetry tracing for GitLab CI pipelines so you can finally see where build time actually goes, stage by stage and job by job.Thu, 18 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdaiopentelemetryobservabilityhttps://devopsaitoolkit.com/blog/managing-accelerators-with-openstack-cyborg/https://devopsaitoolkit.com/blog/managing-accelerators-with-openstack-cyborg/Cyborg gives OpenStack a way to manage GPUs, FPGAs, and other accelerators. Here is how I configure device profiles, attach them to instances, and debug with AI help.Thu, 18 Jun 2026 00:00:00 GMTopenstackopenstackcyborggpuacceleratorsdevopshttps://devopsaitoolkit.com/blog/managing-ansible-galaxy-dependencies-and-requirements-with-ai/https://devopsaitoolkit.com/blog/managing-ansible-galaxy-dependencies-and-requirements-with-ai/Use AI to audit Ansible Galaxy requirements.yml, pin role and collection versions, tame transitive dependencies, and keep your supply chain trustworthy.Thu, 18 Jun 2026 00:00:00 GMTansibleiacansiblesupply-chainautomationhttps://devopsaitoolkit.com/blog/managing-disk-quotas-on-linux-with-ai-assistance/https://devopsaitoolkit.com/blog/managing-disk-quotas-on-linux-with-ai-assistance/User and group quotas stop one account from filling a shared filesystem. Here's how to enable, set, and report quotas with an AI assistant decoding the tooling.Thu, 18 Jun 2026 00:00:00 GMTlinux-adminslinuxquotasfilesystemsstoragexfshttps://devopsaitoolkit.com/blog/managing-fstab-and-mounts-on-linux-with-ai/https://devopsaitoolkit.com/blog/managing-fstab-and-mounts-on-linux-with-ai/A bad fstab entry can stop a server from booting. Here's how to add mounts safely, test before reboot, and use AI to vet every line before it goes live.Thu, 18 Jun 2026 00:00:00 GMTlinux-adminslinuxfstabmountsfilesystemssystemdhttps://devopsaitoolkit.com/blog/managing-systemd-tmpfiles-and-temp-directory-cleanup-with-ai/https://devopsaitoolkit.com/blog/managing-systemd-tmpfiles-and-temp-directory-cleanup-with-ai/Runaway temp files quietly fill disks. Here's how to write systemd-tmpfiles.d rules to create and age out files, with an AI assistant vetting the syntax.Thu, 18 Jun 2026 00:00:00 GMTlinux-adminslinuxsystemdtmpfilescleanupdiskhttps://devopsaitoolkit.com/blog/microsoft-graph-delta-queries-for-incremental-teams-sync/https://devopsaitoolkit.com/blog/microsoft-graph-delta-queries-for-incremental-teams-sync/Stop re-fetching every user and team on each run. Graph delta queries return only what changed since last time, cutting throttling and runtime dramatically.Thu, 18 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsmicrosoft-graphdelta-querysyncautomationhttps://devopsaitoolkit.com/blog/migrating-docker-compose-to-kubernetes-with-ai/https://devopsaitoolkit.com/blog/migrating-docker-compose-to-kubernetes-with-ai/A practical walkthrough of converting a docker-compose.yml into clean Kubernetes manifests with AI drafting the boilerplate and you reviewing every line.Thu, 18 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesdocker-composemigrationaihttps://devopsaitoolkit.com/blog/migrating-from-puppet-and-chef-to-ansible-with-ai/https://devopsaitoolkit.com/blog/migrating-from-puppet-and-chef-to-ansible-with-ai/Map Puppet manifests and Chef cookbooks to Ansible roles, using AI to draft the translation while you review every change, run check mode, and prove idempotency.Thu, 18 Jun 2026 00:00:00 GMTansibleiacansiblepuppetchefmigrationhttps://devopsaitoolkit.com/blog/migrating-github-actions-to-gitlab-ci-with-ai/https://devopsaitoolkit.com/blog/migrating-github-actions-to-gitlab-ci-with-ai/Use AI to translate GitHub Actions YAML into idiomatic GitLab CI: map jobs and steps to stages, convert matrix builds, triggers, and secrets safely.Thu, 18 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdaigithub-actionsmigrationhttps://devopsaitoolkit.com/blog/migrating-linux-users-and-groups-between-servers-with-ai/https://devopsaitoolkit.com/blog/migrating-linux-users-and-groups-between-servers-with-ai/Moving accounts to a new box means matching UIDs, hashes, and group memberships without breaking file ownership. Here's a safe migration workflow with AI help.Thu, 18 Jun 2026 00:00:00 GMTlinux-adminslinuxusersmigrationpermissionspasswdhttps://devopsaitoolkit.com/blog/migrating-nagios-checks-to-prometheus-alerts-with-ai/https://devopsaitoolkit.com/blog/migrating-nagios-checks-to-prometheus-alerts-with-ai/AI can translate hundreds of Nagios checks to Prometheus alert rules fast, but a naive port recreates years of alert noise. How I migrate without the rot.Thu, 18 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusnagiosmigrationalertingaihttps://devopsaitoolkit.com/blog/modernizing-ansible-loops-from-with-items-to-loop-with-ai/https://devopsaitoolkit.com/blog/modernizing-ansible-loops-from-with-items-to-loop-with-ai/Use AI to translate legacy Ansible with_items, with_dict, and with_subelements into the modern loop keyword with loop_control, query, and filters.Thu, 18 Jun 2026 00:00:00 GMTansibleiacansibleautomationai-toolinghttps://devopsaitoolkit.com/blog/modernizing-legacy-terraform-hcl-syntax-with-ai/https://devopsaitoolkit.com/blog/modernizing-legacy-terraform-hcl-syntax-with-ai/Old Terraform is full of count hacks, interpolation syntax, and deprecated arguments. AI can modernize HCL fast, but only a clean plan proves it was right.Thu, 18 Jun 2026 00:00:00 GMTterraformterraformairefactoringhclmodernizationhttps://devopsaitoolkit.com/blog/monitoring-as-a-service-with-openstack-monasca/https://devopsaitoolkit.com/blog/monitoring-as-a-service-with-openstack-monasca/Monasca delivers scalable, multi-tenant monitoring for OpenStack. Here is how I push metrics, build alarm definitions, and let AI draft expressions without breaking prod.Thu, 18 Jun 2026 00:00:00 GMTopenstackopenstackmonascamonitoringalarmsdevopshttps://devopsaitoolkit.com/blog/monitoring-vendor-status-pages-during-incidents-with-ai/https://devopsaitoolkit.com/blog/monitoring-vendor-status-pages-during-incidents-with-ai/When your incident is actually a vendor's outage, finding out fast saves an hour. Here's how to use AI to triage third-party status pages without trusting it to act.Thu, 18 Jun 2026 00:00:00 GMTincident-responseincident-responseaidependenciesvendorssrehttps://devopsaitoolkit.com/blog/parsing-yaml-in-bash-and-python-with-yq-and-pyyaml/https://devopsaitoolkit.com/blog/parsing-yaml-in-bash-and-python-with-yq-and-pyyaml/YAML runs your infra but bash can't parse it safely. Use yq in scripts and PyYAML in Python, with AI to draft the queries — and dodge the classic gotchas.Thu, 18 Jun 2026 00:00:00 GMTbash-python-automationbashpythonyamlyqautomationhttps://devopsaitoolkit.com/blog/power-automate-error-handling-retries-and-try-catch-scopes/https://devopsaitoolkit.com/blog/power-automate-error-handling-retries-and-try-catch-scopes/Flows fail silently and you find out from an angry channel. Learn run-after configs, retry policies, and Scope-based try-catch to make Teams flows resilient.Thu, 18 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamspower-automateerror-handlingresiliencedevopshttps://devopsaitoolkit.com/blog/profiling-linux-performance-with-perf-and-ai/https://devopsaitoolkit.com/blog/profiling-linux-performance-with-perf-and-ai/perf is the most powerful Linux profiler nobody reads the output of. Here's how to capture flame graphs and let AI translate cryptic stacks into a fix plan.Thu, 18 Jun 2026 00:00:00 GMTlinux-adminslinuxperfperformanceprofilingflamegraphhttps://devopsaitoolkit.com/blog/pull-based-config-management-with-ansible-pull-and-ai/https://devopsaitoolkit.com/blog/pull-based-config-management-with-ansible-pull-and-ai/How ansible-pull flips Ansible's push model so ephemeral and edge nodes self-configure on boot. Setup, systemd timers, cloud-init bootstrap, and AI scaffolding.Thu, 18 Jun 2026 00:00:00 GMTansibleiacansibleautomationsystemdhttps://devopsaitoolkit.com/blog/redacting-secrets-and-pii-from-logs-with-ai/https://devopsaitoolkit.com/blog/redacting-secrets-and-pii-from-logs-with-ai/Logs leak more than you think: tokens, emails, card fragments. Here's how I use AI to audit logging code and build redaction patterns before sensitive data hits disk.Thu, 18 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningloggingpiiaihttps://devopsaitoolkit.com/blog/reducing-alert-fatigue-with-ai-pager-noise/https://devopsaitoolkit.com/blog/reducing-alert-fatigue-with-ai-pager-noise/Alert fatigue burns out your best responders and hides real incidents. Here's how to use AI to analyze noisy alerts and propose tuning without trusting it to silence anything.Thu, 18 Jun 2026 00:00:00 GMTincident-responseincident-responseaialertingon-callsrehttps://devopsaitoolkit.com/blog/refactoring-ansible-conditionals-and-when-logic-with-ai/https://devopsaitoolkit.com/blog/refactoring-ansible-conditionals-and-when-logic-with-ai/Use AI to untangle messy Ansible when conditionals, fix bare-variable traps and Jinja gotchas, and flatten nested logic into readable, reviewable plays.Thu, 18 Jun 2026 00:00:00 GMTansibleiacansibleautomationrefactoringhttps://devopsaitoolkit.com/blog/refactoring-configmaps-and-secrets-with-ai/https://devopsaitoolkit.com/blog/refactoring-configmaps-and-secrets-with-ai/Sprawling ConfigMaps and inline secrets rot over time. Use AI to consolidate config, split out real secrets, and trigger clean rollouts you verify first.Thu, 18 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesconfigmapsecretsaihttps://devopsaitoolkit.com/blog/reviewing-cloud-security-group-rules-with-ai/https://devopsaitoolkit.com/blog/reviewing-cloud-security-group-rules-with-ai/0.0.0.0/0 on the wrong port is a breach waiting to happen. Here's how I use AI to audit AWS, GCP, and Azure firewall rules for over-broad ingress and stale openings.Thu, 18 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningcloudfirewallaihttps://devopsaitoolkit.com/blog/reviewing-kubernetes-networkpolicy-default-deny-with-ai/https://devopsaitoolkit.com/blog/reviewing-kubernetes-networkpolicy-default-deny-with-ai/A flat cluster network is one compromised pod away from full lateral movement. Here's how I use AI to audit NetworkPolicies toward default-deny without breaking traffic.Thu, 18 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningkubernetesnetworkpolicyaihttps://devopsaitoolkit.com/blog/reviewing-terraform-network-and-security-group-changes-with-ai/https://devopsaitoolkit.com/blog/reviewing-terraform-network-and-security-group-changes-with-ai/A single 0.0.0.0/0 in a Terraform security group can expose a database to the internet. AI is a sharp second pair of eyes on network diffs, used carefully.Thu, 18 Jun 2026 00:00:00 GMTterraformterraformainetworkingsecurityreviewhttps://devopsaitoolkit.com/blog/right-sizing-terraform-managed-resources-with-ai/https://devopsaitoolkit.com/blog/right-sizing-terraform-managed-resources-with-ai/Over-provisioned instances and bloated disks hide in plain sight in Terraform. AI can turn utilization metrics into right-sizing suggestions you review and apply.Thu, 18 Jun 2026 00:00:00 GMTterraformterraformaicostright-sizingoptimizationhttps://devopsaitoolkit.com/blog/root-cause-analysis-with-openstack-vitrage/https://devopsaitoolkit.com/blog/root-cause-analysis-with-openstack-vitrage/Vitrage correlates alarms into root causes across your OpenStack cloud. Here is how I configure templates, read the entity graph, and use AI to cut through alarm storms.Thu, 18 Jun 2026 00:00:00 GMTopenstackopenstackvitragercaalarmsdevopshttps://devopsaitoolkit.com/blog/sandboxing-services-with-landlock-and-ai-review/https://devopsaitoolkit.com/blog/sandboxing-services-with-landlock-and-ai-review/Landlock lets a process drop its own filesystem access at runtime. Here's how I use AI to scope a least-privilege sandbox and review the rules before they ship.Thu, 18 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeninglinuxlandlocksandboxinghttps://devopsaitoolkit.com/blog/scaffolding-multi-environment-terraform-tfvars-with-ai/https://devopsaitoolkit.com/blog/scaffolding-multi-environment-terraform-tfvars-with-ai/Dev, staging, and prod tfvars drift apart one copy-paste at a time. AI can generate consistent per-environment variable files — if you keep it away from secrets.Thu, 18 Jun 2026 00:00:00 GMTterraformterraformaitfvarsenvironmentsvariableshttps://devopsaitoolkit.com/blog/sending-email-and-alerts-from-scripts-with-python-smtplib/https://devopsaitoolkit.com/blog/sending-email-and-alerts-from-scripts-with-python-smtplib/Scripts still need to email reports and alerts. Use AI to draft smtplib senders, then verify TLS, escape user content, and keep SMTP credentials out of code.Thu, 18 Jun 2026 00:00:00 GMTbash-python-automationbashpythonemailsmtpautomationhttps://devopsaitoolkit.com/blog/stream-ai-responses-in-teams-bots-with-typing-and-updates/https://devopsaitoolkit.com/blog/stream-ai-responses-in-teams-bots-with-typing-and-updates/A bot that stalls for ten seconds feels broken. Use typing indicators and message updates to stream LLM responses into Teams so the conversation feels alive.Thu, 18 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsbot-frameworkaistreamingchatopshttps://devopsaitoolkit.com/blog/tracking-slo-breaches-and-error-budgets-during-incidents-with-ai/https://devopsaitoolkit.com/blog/tracking-slo-breaches-and-error-budgets-during-incidents-with-ai/Mid-incident, nobody can do error-budget math in their head. Here's how to use AI to track SLO burn and budget impact in real time so decisions stay grounded in data.Thu, 18 Jun 2026 00:00:00 GMTincident-responseincident-responseaisloerror-budgetsrehttps://devopsaitoolkit.com/blog/translating-cryptic-error-logs-into-plain-english-with-ai/https://devopsaitoolkit.com/blog/translating-cryptic-error-logs-into-plain-english-with-ai/A wall of stack traces at 3am helps nobody think clearly. Here's how to use AI to translate cryptic logs into plain-language explanations without trusting it blindly.Thu, 18 Jun 2026 00:00:00 GMTincident-responseincident-responseaiobservabilitydebuggingsrehttps://devopsaitoolkit.com/blog/troubleshooting-nfs-and-samba-shares-on-linux-with-ai/https://devopsaitoolkit.com/blog/troubleshooting-nfs-and-samba-shares-on-linux-with-ai/Stale handles, permission mismatches, and hung mounts make file shares miserable. Here's a diagnostic workflow for NFS and Samba with AI decoding the errors.Thu, 18 Jun 2026 00:00:00 GMTlinux-adminslinuxnfssambanetworkingstoragehttps://devopsaitoolkit.com/blog/tuning-ansible-performance-forks-pipelining-and-fact-caching/https://devopsaitoolkit.com/blog/tuning-ansible-performance-forks-pipelining-and-fact-caching/Cut slow Ansible runs from 40 minutes to a few. A practical guide to forks, pipelining, SSH ControlPersist, fact caching, async, and profiling slow tasks.Thu, 18 Jun 2026 00:00:00 GMTansibleiacansibleautomationperformancehttps://devopsaitoolkit.com/blog/unit-testing-prometheus-alert-rules-with-promtool-and-ai/https://devopsaitoolkit.com/blog/unit-testing-prometheus-alert-rules-with-promtool-and-ai/AI can write promtool unit tests for your alert rules in seconds, but only you can decide what they should prove. How I generate and review alert rule tests.Thu, 18 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusalertingtestingaipromtoolhttps://devopsaitoolkit.com/blog/untangling-systemd-boot-time-with-systemd-analyze-and-ai/https://devopsaitoolkit.com/blog/untangling-systemd-boot-time-with-systemd-analyze-and-ai/Slow boots and tangled service dependencies hide in plain sight. Here's how to read systemd-analyze blame and critical-chain with an AI decoding the graph.Thu, 18 Jun 2026 00:00:00 GMTlinux-adminslinuxsystemdbootperformancedependencieshttps://devopsaitoolkit.com/blog/upgrading-helm-charts-across-major-versions-with-ai/https://devopsaitoolkit.com/blog/upgrading-helm-charts-across-major-versions-with-ai/Major Helm chart upgrades break things in subtle ways. Use AI to diff CHANGELOGs, map renamed values, and plan a safe upgrade you verify before applying.Thu, 18 Jun 2026 00:00:00 GMTkubernetes-helmkuberneteshelmupgradesaihttps://devopsaitoolkit.com/blog/using-ai-to-debug-gitlab-ci-cache-misses/https://devopsaitoolkit.com/blog/using-ai-to-debug-gitlab-ci-cache-misses/Use AI to diagnose GitLab CI cache key, path, and policy mistakes that cause cache misses, slow pipelines, and wasted runner minutes, then verify fixes.Thu, 18 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdaicachingperformancehttps://devopsaitoolkit.com/blog/using-ai-to-quarantine-flaky-tests-in-gitlab-ci/https://devopsaitoolkit.com/blog/using-ai-to-quarantine-flaky-tests-in-gitlab-ci/Use AI to spot flaky tests from GitLab CI JUnit reports, cluster them apart from real failures, and auto-quarantine the offenders so your pipelines stay green.Thu, 18 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdaitestingflaky-testshttps://devopsaitoolkit.com/blog/using-ai-to-speed-up-docker-builds-in-gitlab-ci/https://devopsaitoolkit.com/blog/using-ai-to-speed-up-docker-builds-in-gitlab-ci/Cut Docker build times in GitLab CI using AI to fix layer ordering, wire up BuildKit registry cache with buildx, and push inline cache for fast, reliable rebuilds.Thu, 18 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdaidockerbuildkithttps://devopsaitoolkit.com/blog/using-ai-to-turn-gitlab-pipeline-failures-into-clear-summaries/https://devopsaitoolkit.com/blog/using-ai-to-turn-gitlab-pipeline-failures-into-clear-summaries/Use AI to parse noisy GitLab CI job logs into a one-paragraph root-cause summary and post it straight to the merge request or chat, so you stop scrolling red.Thu, 18 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdaidebuggingobservabilityhttps://devopsaitoolkit.com/blog/validate-graph-change-notifications-and-decrypt-resource-data/https://devopsaitoolkit.com/blog/validate-graph-change-notifications-and-decrypt-resource-data/Microsoft Graph webhooks demand a validation handshake and optional encrypted payloads. Here is how to handle both correctly so your Teams automation never misses an event.Thu, 18 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsmicrosoft-graphwebhookssecurityautomationhttps://devopsaitoolkit.com/blog/validating-openstack-clouds-with-tempest-and-ai/https://devopsaitoolkit.com/blog/validating-openstack-clouds-with-tempest-and-ai/Tempest is the integration test suite that proves your OpenStack cloud actually works. Here is how I configure it, triage failures, and let AI read the tracebacks for me.Thu, 18 Jun 2026 00:00:00 GMTopenstackopenstacktempesttestingvalidationdevopshttps://devopsaitoolkit.com/blog/what-is-infrastructure-observability-a-2026-guide/https://devopsaitoolkit.com/blog/what-is-infrastructure-observability-a-2026-guide/What infrastructure observability is, how it differs from monitoring, the core signals (metrics, logs, traces), and how to implement it without drowning in data.Thu, 18 Jun 2026 00:00:00 GMTprometheus-monitoringobservabilitymonitoringopentelemetrysredevopshttps://devopsaitoolkit.com/blog/writing-ansible-filter-plugins-in-python-with-ai/https://devopsaitoolkit.com/blog/writing-ansible-filter-plugins-in-python-with-ai/Turn unreadable Jinja2 one-liners into clean, testable Ansible filter plugins in Python — with AI scaffolding the code and tests while you review every line.Thu, 18 Jun 2026 00:00:00 GMTansibleiacansiblepythonjinja2automationhttps://devopsaitoolkit.com/blog/writing-kubectl-krew-plugins-with-ai/https://devopsaitoolkit.com/blog/writing-kubectl-krew-plugins-with-ai/Turn the kubectl command you keep retyping into a real plugin. AI drafts the script and krew manifest; you review and install it locally for the whole team.Thu, 18 Jun 2026 00:00:00 GMTkubernetes-helmkuberneteskubectlkrewaihttps://devopsaitoolkit.com/blog/writing-pre-commit-hooks-for-ops-repos-with-ai/https://devopsaitoolkit.com/blog/writing-pre-commit-hooks-for-ops-repos-with-ai/pre-commit hooks stop bad commits at the source. Use AI to draft custom Bash and Python hooks, then review them so they fail loud and never leak secrets.Thu, 18 Jun 2026 00:00:00 GMTbash-python-automationbashpythonpre-commitgitautomationhttps://devopsaitoolkit.com/blog/writing-safe-sed-and-awk-bulk-edits-with-ai-review/https://devopsaitoolkit.com/blog/writing-safe-sed-and-awk-bulk-edits-with-ai-review/Use AI to generate and review sed and awk one-liners for bulk file edits, with previews, backups, and tight globs so you never silently corrupt hundreds of files.Thu, 18 Jun 2026 00:00:00 GMTautomationautomationsedawkbashhttps://devopsaitoolkit.com/blog/writing-sigma-detection-rules-with-ai/https://devopsaitoolkit.com/blog/writing-sigma-detection-rules-with-ai/Sigma is portable detection-as-code for your SIEM. Here's how I use AI to draft rules, tune out noise, and map fields to my log schema, with a human verifying every rule.Thu, 18 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningsigmasiemdetectionhttps://devopsaitoolkit.com/blog/writing-terraform-data-source-queries-with-ai/https://devopsaitoolkit.com/blog/writing-terraform-data-source-queries-with-ai/Hardcoded AMI IDs and subnet ARNs rot the moment infrastructure shifts. AI is great at turning them into data source lookups — verified against a real plan.Thu, 18 Jun 2026 00:00:00 GMTterraformterraformaidata-sourceshclbest-practiceshttps://devopsaitoolkit.com/blog/writing-udev-rules-on-linux-with-ai-assistance/https://devopsaitoolkit.com/blog/writing-udev-rules-on-linux-with-ai-assistance/udev rules control how Linux names and reacts to devices, and the syntax is unforgiving. Here's how to inspect attributes and let AI draft rules you can verify.Thu, 18 Jun 2026 00:00:00 GMTlinux-adminslinuxudevdeviceskernelautomationhttps://devopsaitoolkit.com/blog/action-execute-vs-action-submit-in-teams-adaptive-cards/https://devopsaitoolkit.com/blog/action-execute-vs-action-submit-in-teams-adaptive-cards/Action.Submit and Action.Execute look similar but behave very differently in Teams bots. Here's when to use each, with invoke handling and card refresh detail.Wed, 17 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsadaptive-cardsbot-frameworkactionschatopshttps://devopsaitoolkit.com/blog/ai-assisted-threat-modeling-with-stride/https://devopsaitoolkit.com/blog/ai-assisted-threat-modeling-with-stride/Use STRIDE and an LLM to threat model systems fast, turning enumerated threats into mitigations and tickets without the design review process stalling out.Wed, 17 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningthreat-modelingstridedesign-reviewhttps://devopsaitoolkit.com/blog/alertmanager-inhibition-and-silences-done-right/https://devopsaitoolkit.com/blog/alertmanager-inhibition-and-silences-done-right/Stop alert storms with Alertmanager inhibit_rules and silences. Real source/target matcher YAML, amtool commands, expiring silences, and review tips.Wed, 17 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusalertmanagerinhibitionalertingsrehttps://devopsaitoolkit.com/blog/ansible-block-rescue-always-error-handling-with-ai/https://devopsaitoolkit.com/blog/ansible-block-rescue-always-error-handling-with-ai/Use AI as a fast junior engineer to add block/rescue/always recovery to Ansible playbooks, then have a human review every change and run --check first.Wed, 17 Jun 2026 00:00:00 GMTansibleiacansibleaierror-handlingplaybookshttps://devopsaitoolkit.com/blog/ansible-callback-plugins-for-better-logging-and-observability/https://devopsaitoolkit.com/blog/ansible-callback-plugins-for-better-logging-and-observability/Use AI to configure and write Ansible callback plugins for profiling, logging and observability, with human review, dry runs, and secret scrubbing.Wed, 17 Jun 2026 00:00:00 GMTansibleiacansibleaiobservabilitypluginshttps://devopsaitoolkit.com/blog/ansible-handlers-done-right-with-ai-notify-listen-flush/https://devopsaitoolkit.com/blog/ansible-handlers-done-right-with-ai-notify-listen-flush/Use AI to fix Ansible handler logic with notify, listen, and flush_handlers so services restart only when they should, with every change human-reviewed.Wed, 17 Jun 2026 00:00:00 GMTansibleiacansibleaihandlersplaybookshttps://devopsaitoolkit.com/blog/api-fuzz-and-coverage-guided-testing-in-gitlab-ci/https://devopsaitoolkit.com/blog/api-fuzz-and-coverage-guided-testing-in-gitlab-ci/Your tests only check the inputs you imagined. GitLab CI fuzz testing throws the ones you did not: how to wire up API and coverage-guided fuzzing with AI help.Wed, 17 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdsecuritytestinghttps://devopsaitoolkit.com/blog/bash-exit-codes-pipefail-and-pipestatus-for-reliable-pipelines/https://devopsaitoolkit.com/blog/bash-exit-codes-pipefail-and-pipestatus-for-reliable-pipelines/A failing command in the middle of a Bash pipe can be invisible by default. Learn pipefail, PIPESTATUS, and exit-code conventions to stop silent failures.Wed, 17 Jun 2026 00:00:00 GMTbash-python-automationbashpythonreliabilityhttps://devopsaitoolkit.com/blog/bash-here-documents-and-config-templating-without-the-mess/https://devopsaitoolkit.com/blog/bash-here-documents-and-config-templating-without-the-mess/Generate config files, SQL, and multi-line payloads from Bash cleanly. A practical guide to here-docs, here-strings, and safe variable expansion in templates.Wed, 17 Jun 2026 00:00:00 GMTbash-python-automationbashpythonconfighttps://devopsaitoolkit.com/blog/bash-trap-cleanup-and-temp-file-management-for-safe-scripts/https://devopsaitoolkit.com/blog/bash-trap-cleanup-and-temp-file-management-for-safe-scripts/Stop leaving stale temp files and half-finished state behind. Use Bash trap and mktemp to build automation that cleans up after itself, even when it crashes.Wed, 17 Jun 2026 00:00:00 GMTbash-python-automationbashpythonreliabilityhttps://devopsaitoolkit.com/blog/best-ai-prompts-for-linux-system-administrators/https://devopsaitoolkit.com/blog/best-ai-prompts-for-linux-system-administrators/The best AI prompts for Linux system administrators give the model an expert persona, your real specifics, and a verification command plus a back-out path.Wed, 17 Jun 2026 00:00:00 GMTlinux-adminslinuxai-promptssysadmindevopsautomationhttps://devopsaitoolkit.com/blog/best-way-to-learn-terraform-for-real-world-infrastructure/https://devopsaitoolkit.com/blog/best-way-to-learn-terraform-for-real-world-infrastructure/The best way to learn Terraform is to build real infrastructure in a throwaway cloud account, in a deliberate order, with state, modules, and CI from day one.Wed, 17 Jun 2026 00:00:00 GMTterraformterraformiaclearningdevopsautomationhttps://devopsaitoolkit.com/blog/better-terminal-output-for-python-ops-tools-with-rich/https://devopsaitoolkit.com/blog/better-terminal-output-for-python-ops-tools-with-rich/Tables, progress bars, colored logs, and readable tracebacks. How the rich library turns a wall of print() statements into a CLI your team enjoys using.Wed, 17 Jun 2026 00:00:00 GMTbash-python-automationpythonbashclihttps://devopsaitoolkit.com/blog/bonding-network-interfaces-for-redundancy-on-linux/https://devopsaitoolkit.com/blog/bonding-network-interfaces-for-redundancy-on-linux/Configure Linux NIC bonding modes like active-backup and 802.3ad LACP for redundancy and bandwidth using systemd-networkd, nmcli, and a little AI help.Wed, 17 Jun 2026 00:00:00 GMTlinux-adminslinuxnetworkingbondingredundancyhttps://devopsaitoolkit.com/blog/build-a-custom-connector-for-power-automate-to-reach-internal-apis/https://devopsaitoolkit.com/blog/build-a-custom-connector-for-power-automate-to-reach-internal-apis/Out-of-box connectors can't reach your internal DevOps APIs. A custom connector wraps your OpenAPI spec so Teams flows can call it. Here's the build, secured.Wed, 17 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamspower-automatecustom-connectoropenapiintegrationhttps://devopsaitoolkit.com/blog/build-sequential-approval-flows-in-power-automate-for-teams/https://devopsaitoolkit.com/blog/build-sequential-approval-flows-in-power-automate-for-teams/Single-approver flows don't survive real change control. Here's how to build multi-stage sequential and parallel approvals in Power Automate, surfaced in Teams.Wed, 17 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamspower-automateapprovalschange-managementworkflowshttps://devopsaitoolkit.com/blog/building-a-stakeholder-notification-matrix-for-incidents/https://devopsaitoolkit.com/blog/building-a-stakeholder-notification-matrix-for-incidents/Stop guessing who to notify during an outage. Build a stakeholder notification matrix and use AI to draft the right message for each audience in seconds.Wed, 17 Jun 2026 00:00:00 GMTincident-responseincident-responsecommunicationprocesssrehttps://devopsaitoolkit.com/blog/building-multi-arch-container-images-for-kubernetes/https://devopsaitoolkit.com/blog/building-multi-arch-container-images-for-kubernetes/Mixed arm64 and amd64 nodes break single-arch images. Learn to build multi-arch manifests with buildx, test them, and avoid exec format errors in Kubernetes.Wed, 17 Jun 2026 00:00:00 GMTkubernetes-helmkubernetescontainersdockerarm64ci-cdhttps://devopsaitoolkit.com/blog/building-reconciliation-loops-for-self-correcting-automation/https://devopsaitoolkit.com/blog/building-reconciliation-loops-for-self-correcting-automation/Imperative scripts fire once and forget. Reconciliation loops continuously converge reality to desired state, so automation heals drift instead of just hoping.Wed, 17 Jun 2026 00:00:00 GMTautomationautomationreconciliationcontrollersdriftsrehttps://devopsaitoolkit.com/blog/canary-tokens-and-honeytokens-for-breach-detection/https://devopsaitoolkit.com/blog/canary-tokens-and-honeytokens-for-breach-detection/Canary tokens and honeytokens turn an attacker's curiosity into an early-warning alarm. Here's how I plant fake creds and decoy files to detect breaches fast.Wed, 17 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningdetectionhoneytokensblue-teamhttps://devopsaitoolkit.com/blog/cinder-volume-backups-and-disaster-recovery-openstack/https://devopsaitoolkit.com/blog/cinder-volume-backups-and-disaster-recovery-openstack/Snapshots aren't backups. Here's how to build a real Cinder backup and DR strategy in OpenStack with incremental backups, restores, and AI-assisted runbooks.Wed, 17 Jun 2026 00:00:00 GMTopenstackopenstackcinderbackupdisaster-recoverystoragehttps://devopsaitoolkit.com/blog/configuring-logrotate-to-stop-runaway-log-growth/https://devopsaitoolkit.com/blog/configuring-logrotate-to-stop-runaway-log-growth/Write and debug logrotate configs that keep Linux log directories from filling the disk, using AI as a fast junior pair to draft and test rotation rules.Wed, 17 Jun 2026 00:00:00 GMTlinux-adminslinuxlogrotateloggingdiskhttps://devopsaitoolkit.com/blog/configuring-static-networking-with-systemd-networkd/https://devopsaitoolkit.com/blog/configuring-static-networking-with-systemd-networkd/Manage Linux network config with systemd-networkd .network and .netdev files instead of legacy ifupdown or NetworkManager, with AI help and a human in the loop.Wed, 17 Jun 2026 00:00:00 GMTlinux-adminslinuxsystemdnetworkingsystemd-networkdhttps://devopsaitoolkit.com/blog/confining-linux-services-with-apparmor-profiles/https://devopsaitoolkit.com/blog/confining-linux-services-with-apparmor-profiles/Learn to write, test, and enforce AppArmor profiles that confine Linux services using aa-genprof and audit logs, with AI help and a human in the loop.Wed, 17 Jun 2026 00:00:00 GMTlinux-adminslinuxapparmorsecurityhardeninghttps://devopsaitoolkit.com/blog/csi-volume-snapshots-for-stateful-workloads/https://devopsaitoolkit.com/blog/csi-volume-snapshots-for-stateful-workloads/Stateful pods need point-in-time backups, not just replicas. Learn how CSI VolumeSnapshots, snapshot classes, and restore flows protect Kubernetes data.Wed, 17 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesstoragecsibackupstatefulhttps://devopsaitoolkit.com/blog/customizing-gitlab-auto-devops-without-fighting-it/https://devopsaitoolkit.com/blog/customizing-gitlab-auto-devops-without-fighting-it/Auto DevOps gets you to a deploy in minutes, then fights you for months. Here is how I override just the parts I need and use AI to decode the hidden template.Wed, 17 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdauto-devopsaihttps://devopsaitoolkit.com/blog/dead-letter-queue-triage-with-ai-assistance/https://devopsaitoolkit.com/blog/dead-letter-queue-triage-with-ai-assistance/A growing dead-letter queue is a pile of failed work and hidden bugs. Here's a workflow to triage DLQs with AI help — classify, cluster, fix, and safely replay.Wed, 17 Jun 2026 00:00:00 GMTautomationautomationdlqmessagingincident-responsereliabilityhttps://devopsaitoolkit.com/blog/debugging-neutron-floating-ips-and-nat-openstack/https://devopsaitoolkit.com/blog/debugging-neutron-floating-ips-and-nat-openstack/Floating IPs that don't route, DNAT that silently drops, and SNAT egress failures. Here's how to trace OpenStack L3 NAT through routers and namespaces, with AI help.Wed, 17 Jun 2026 00:00:00 GMTopenstackopenstackneutronfloating-ipnatnetworkinghttps://devopsaitoolkit.com/blog/deployment-approval-gates-with-gitlab-protected-environments/https://devopsaitoolkit.com/blog/deployment-approval-gates-with-gitlab-protected-environments/Manual jobs alone do not protect production. Here is how I build real approval gates with GitLab protected environments and audited deployment approvals.Wed, 17 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cddeploymentsgovernancehttps://devopsaitoolkit.com/blog/detecting-dead-targets-with-absent-and-staleness/https://devopsaitoolkit.com/blog/detecting-dead-targets-with-absent-and-staleness/How to alert when a Prometheus metric stops existing using absent(), absent_over_time(), and up==0, plus the staleness rules that silently break no-data alerts.Wed, 17 Jun 2026 00:00:00 GMTprometheus-monitoringprometheuspromqlalertingstalenesssrehttps://devopsaitoolkit.com/blog/dns-egress-filtering-and-exfiltration-detection/https://devopsaitoolkit.com/blog/dns-egress-filtering-and-exfiltration-detection/Lock down outbound name resolution: force DNS through a resolver, allowlist egress domains, log queries, and detect DNS tunneling and C2 before data leaves.Wed, 17 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningdnsnetworkingdetectionhttps://devopsaitoolkit.com/blog/enforcing-tenant-labels-in-multi-tenant-prometheus/https://devopsaitoolkit.com/blog/enforcing-tenant-labels-in-multi-tenant-prometheus/How to inject and validate tenant/team labels with relabel_configs, write_relabel_configs, and X-Scope-OrgID so cost attribution and access control hold up.Wed, 17 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusmimirmulti-tenancyrelabelingsrehttps://devopsaitoolkit.com/blog/enforcing-terraform-standards-with-tflint-and-ai-authored-rules/https://devopsaitoolkit.com/blog/enforcing-terraform-standards-with-tflint-and-ai-authored-rules/Use TFLint to enforce Terraform conventions and catch provider-specific errors, with AI drafting config and lint rules that a human reviews before they land.Wed, 17 Jun 2026 00:00:00 GMTterraformterraformtflintlintingstandardsaihttps://devopsaitoolkit.com/blog/ephemeral-slack-messages-for-quieter-ops-bots/https://devopsaitoolkit.com/blog/ephemeral-slack-messages-for-quieter-ops-bots/Use chat.postEphemeral and ephemeral responses to give one user feedback without spamming the channel. AI drafts the handlers; you review before shipping.Wed, 17 Jun 2026 00:00:00 GMTslackslackchatopsblock-kituxhttps://devopsaitoolkit.com/blog/facilitating-the-major-incident-bridge-call/https://devopsaitoolkit.com/blog/facilitating-the-major-incident-bridge-call/How to run a major incident bridge call that stays focused, with AI handling notes and side-channel synthesis so the facilitator can keep humans coordinated.Wed, 17 Jun 2026 00:00:00 GMTincident-responseincident-responseincident-commanderprocesscommunicationhttps://devopsaitoolkit.com/blog/finding-systemic-themes-across-postmortems-with-ai/https://devopsaitoolkit.com/blog/finding-systemic-themes-across-postmortems-with-ai/One postmortem fixes one bug. Use AI to read across dozens of postmortems and surface the systemic patterns that keep generating incidents in the first place.Wed, 17 Jun 2026 00:00:00 GMTpostmortemsincident-responsepostmortemsrereliabilityhttps://devopsaitoolkit.com/blog/from-sbom-to-vex-suppressing-unexploitable-cves-with-evidence/https://devopsaitoolkit.com/blog/from-sbom-to-vex-suppressing-unexploitable-cves-with-evidence/Use VEX and OpenVEX to mark CVEs not_affected with a real justification, cut scanner noise, attach VEX to images, and catch SBOM drift before you ship.Wed, 17 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningvexsbomsupply-chainhttps://devopsaitoolkit.com/blog/generating-cdktf-infrastructure-with-ai-typescript-over-hcl/https://devopsaitoolkit.com/blog/generating-cdktf-infrastructure-with-ai-typescript-over-hcl/How to use AI to scaffold and review CDKTF infrastructure in TypeScript: synth-to-plan workflow, when code beats HCL, and keeping a human on every plan.Wed, 17 Jun 2026 00:00:00 GMTterraformterraformcdktftypescriptaiiachttps://devopsaitoolkit.com/blog/github-actions-reusable-workflows-for-automation-at-scale/https://devopsaitoolkit.com/blog/github-actions-reusable-workflows-for-automation-at-scale/Copy-pasting CI YAML across 40 repos is how drift starts. Reusable workflows and composite actions centralize your pipeline logic so one fix lands everywhere.Wed, 17 Jun 2026 00:00:00 GMTautomationautomationgithub-actionsci-cddevopsyamlhttps://devopsaitoolkit.com/blog/gitlab-ci-artifacts-and-reports-surfacing-results-in-merge-requests/https://devopsaitoolkit.com/blog/gitlab-ci-artifacts-and-reports-surfacing-results-in-merge-requests/JUnit, coverage, code quality, accessibility — GitLab can render all of it inline on the MR. Here is how to wire up every report type, with AI writing the glue.Wed, 17 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdartifactstestinghttps://devopsaitoolkit.com/blog/gitlab-ci-services-running-databases-and-sidecars-in-jobs/https://devopsaitoolkit.com/blog/gitlab-ci-services-running-databases-and-sidecars-in-jobs/Integration tests need a real Postgres, Redis, or Docker daemon. GitLab CI services give you that per-job: here is how to wire them up, with AI on the config.Wed, 17 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdtestingdockerhttps://devopsaitoolkit.com/blog/gitlab-releases-and-changelog-automation-from-your-pipeline/https://devopsaitoolkit.com/blog/gitlab-releases-and-changelog-automation-from-your-pipeline/Hand-written release notes rot fast. Here is how I generate GitLab Releases, changelogs, and release evidence from CI, with AI summarizing the commits.Wed, 17 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdreleaseschangeloghttps://devopsaitoolkit.com/blog/grafana-dashboards-as-code-with-grafonnet/https://devopsaitoolkit.com/blog/grafana-dashboards-as-code-with-grafonnet/Stop hand-editing dashboard JSON. Define Grafana panels and templating as Grafonnet code, generate JSON with jsonnet, provision via Git, and review diffs in CI.Wed, 17 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusgrafanadashboards-as-codejsonnetgitopshttps://devopsaitoolkit.com/blog/handle-microsoft-graph-throttling-and-429s-in-teams-automation/https://devopsaitoolkit.com/blog/handle-microsoft-graph-throttling-and-429s-in-teams-automation/Microsoft Graph throttles hard under load. Here's how to read Retry-After, batch smartly, and back off so your Teams automation survives a 429 storm.Wed, 17 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsgraph-apithrottlingrate-limitsautomationhttps://devopsaitoolkit.com/blog/hardening-http-security-headers-and-content-security-policy/https://devopsaitoolkit.com/blog/hardening-http-security-headers-and-content-security-policy/A practical guide to hardening HTTP security headers and rolling out a Content-Security-Policy from report-only to enforced, with Caddy and edge worker config.Wed, 17 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningweb-securitycsphttp-headershttps://devopsaitoolkit.com/blog/hardening-redis-and-postgres-against-exposure/https://devopsaitoolkit.com/blog/hardening-redis-and-postgres-against-exposure/Lock down Redis and PostgreSQL: binding, requirepass, ACLs, TLS, pg_hba least privilege, scram-sha-256, and finding exposed instances before attackers do.Wed, 17 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningdatabasesredispostgreshttps://devopsaitoolkit.com/blog/hardening-the-slack-events-api-http-endpoint/https://devopsaitoolkit.com/blog/hardening-the-slack-events-api-http-endpoint/Run a public Slack Events API endpoint safely: url_verification, the 3-second ack, retry deduplication, and signatures. AI drafts it; you review the edges.Wed, 17 Jun 2026 00:00:00 GMTslackslackchatopsevents-apireliabilityhttps://devopsaitoolkit.com/blog/hardening-wireguard-for-a-zero-trust-mesh/https://devopsaitoolkit.com/blog/hardening-wireguard-for-a-zero-trust-mesh/Harden WireGuard with least-privilege AllowedIPs, key rotation, preshared keys, and host firewalls so your mesh becomes a zero-trust network, not a flat one.Wed, 17 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningwireguardnetworkingzero-trusthttps://devopsaitoolkit.com/blog/helm-hooks-for-ordered-releases-and-migrations/https://devopsaitoolkit.com/blog/helm-hooks-for-ordered-releases-and-migrations/Helm installs everything at once unless you tell it not to. Learn how pre-install, post-upgrade, and delete hooks sequence migrations and avoid broken releases.Wed, 17 Jun 2026 00:00:00 GMTkubernetes-helmkuberneteshelmmigrationsci-cdrelease-managementhttps://devopsaitoolkit.com/blog/helm-library-charts-for-dry-reusable-templates/https://devopsaitoolkit.com/blog/helm-library-charts-for-dry-reusable-templates/Every service chart in your repo has the same Deployment, Service, and HPA boilerplate. Helm library charts let you define that logic once and import it everywhere.Wed, 17 Jun 2026 00:00:00 GMTkubernetes-helmkuberneteshelmlibrary-chartstemplatesdryhttps://devopsaitoolkit.com/blog/how-ai-helps-write-better-terraform-code/https://devopsaitoolkit.com/blog/how-ai-helps-write-better-terraform-code/AI helps DevOps engineers write better Terraform code by reviewing plans for security and cost risk, generating modules you verify, and refactoring safely.Wed, 17 Jun 2026 00:00:00 GMTterraformterraformaiiaccode-reviewdevopshttps://devopsaitoolkit.com/blog/how-ai-reduces-devops-incident-response-time/https://devopsaitoolkit.com/blog/how-ai-reduces-devops-incident-response-time/How artificial intelligence reduces DevOps incident response time: AI compresses detection, triage, diagnosis, comms, and postmortems to cut MTTR fast.Wed, 17 Jun 2026 00:00:00 GMTreduce-mttrincident-responseaimttrsredevopshttps://devopsaitoolkit.com/blog/how-devops-teams-use-ai-to-reduce-cloud-costs/https://devopsaitoolkit.com/blog/how-devops-teams-use-ai-to-reduce-cloud-costs/How DevOps teams use AI to reduce cloud costs: surface waste from billing data, right-size Kubernetes, explain spikes, and draft IaC fixes humans approve.Wed, 17 Jun 2026 00:00:00 GMTautomationfinopscloud-costaikubernetesdevopshttps://devopsaitoolkit.com/blog/how-to-build-a-production-ready-openstack-cloud/https://devopsaitoolkit.com/blog/how-to-build-a-production-ready-openstack-cloud/Build a production-ready OpenStack cloud: HA control plane, Kolla-Ansible as code, TLS, networking, storage, backups, monitoring, and a tested upgrade path.Wed, 17 Jun 2026 00:00:00 GMTopenstackopenstackkolla-ansibleprivate-cloudproductiondevopshttps://devopsaitoolkit.com/blog/idempotency-keys-for-api-and-webhook-automation/https://devopsaitoolkit.com/blog/idempotency-keys-for-api-and-webhook-automation/Retries and at-least-once delivery mean your automation sees the same request twice. Idempotency keys stop that from charging a card or scaling a cluster twice.Wed, 17 Jun 2026 00:00:00 GMTautomationautomationidempotencywebhooksreliabilityapishttps://devopsaitoolkit.com/blog/incident-command-handoff-during-long-running-outages/https://devopsaitoolkit.com/blog/incident-command-handoff-during-long-running-outages/How to transfer incident command cleanly during multi-hour outages, using AI to brief the incoming commander without losing context or stalling the response.Wed, 17 Jun 2026 00:00:00 GMTincident-responseincident-responseincident-commanderon-callsrehttps://devopsaitoolkit.com/blog/keep-graph-change-notification-subscriptions-alive-with-lifecycle-events/https://devopsaitoolkit.com/blog/keep-graph-change-notification-subscriptions-alive-with-lifecycle-events/Graph change-notification subscriptions expire and silently die. Lifecycle notifications and a renewal loop keep your Teams event pipeline from going dark.Wed, 17 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsgraph-apichange-notificationssubscriptionsautomationhttps://devopsaitoolkit.com/blog/keeping-an-incident-decision-log-with-ai/https://devopsaitoolkit.com/blog/keeping-an-incident-decision-log-with-ai/The decisions made during an incident matter as much as the timeline. Learn to keep a live decision log, with AI capturing the record while humans own the calls.Wed, 17 Jun 2026 00:00:00 GMTincident-responseincident-responseincident-commanderpostmortemprocesshttps://devopsaitoolkit.com/blog/kube-apiserver-audit-policy-logging-what-happened/https://devopsaitoolkit.com/blog/kube-apiserver-audit-policy-logging-what-happened/When something changes in your cluster and nobody admits to it, the audit log has the answer. Learn to write a kube-apiserver audit policy that captures what matters without drowning in noise.Wed, 17 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesauditsecurityapi-servercompliancehttps://devopsaitoolkit.com/blog/kubelet-disk-pressure-image-gc-and-pod-eviction/https://devopsaitoolkit.com/blog/kubelet-disk-pressure-image-gc-and-pod-eviction/Nodes run out of disk more often than memory, and the kubelet's response is to evict pods. Learn how image garbage collection and eviction thresholds work, and how to tune them.Wed, 17 Jun 2026 00:00:00 GMTkubernetes-helmkuberneteskubeletevictiondisk-pressureoperationshttps://devopsaitoolkit.com/blog/kubernetes-priorityclass-and-preemption-explained/https://devopsaitoolkit.com/blog/kubernetes-priorityclass-and-preemption-explained/When a node fills up, Kubernetes decides which pods survive. Learn how PriorityClass and preemption work, the traps that cause cascading evictions, and how to set them safely.Wed, 17 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesschedulingpriorityclasspreemptionreliabilityhttps://devopsaitoolkit.com/blog/kustomize-vs-helm-choosing-the-right-tool/https://devopsaitoolkit.com/blog/kustomize-vs-helm-choosing-the-right-tool/Helm templates, Kustomize patches. Learn the real trade-offs, when to use each, and how to combine them so your Kubernetes manifests stay maintainable.Wed, 17 Jun 2026 00:00:00 GMTkubernetes-helmkuberneteshelmkustomizegitopsconfigurationhttps://devopsaitoolkit.com/blog/lightweight-containers-with-systemd-nspawn/https://devopsaitoolkit.com/blog/lightweight-containers-with-systemd-nspawn/Use systemd-nspawn and machinectl to run lightweight OS containers without Docker on Linux. Build rootfs, network, bind mount, and limit resources with AI help.Wed, 17 Jun 2026 00:00:00 GMTlinux-adminslinuxsystemdcontainersnspawnhttps://devopsaitoolkit.com/blog/managing-gpg-keys-and-encrypting-files-on-linux/https://devopsaitoolkit.com/blog/managing-gpg-keys-and-encrypting-files-on-linux/Generate GPG keys, encrypt and sign files, and manage trust, expiry, and backups on Linux servers, with AI help that keeps a human firmly in the loop.Wed, 17 Jun 2026 00:00:00 GMTlinux-adminslinuxgpgencryptionsecurityhttps://devopsaitoolkit.com/blog/microsoft-graph-batch-requests-for-faster-teams-automation/https://devopsaitoolkit.com/blog/microsoft-graph-batch-requests-for-faster-teams-automation/Stop firing twenty serial Graph calls. The $batch endpoint bundles up to 20 requests into one round trip with dependencies. Here's how to use it without footguns.Wed, 17 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsgraph-apibatchperformanceautomationhttps://devopsaitoolkit.com/blog/mocking-providers-in-terraform-tests-for-fast-offline-runs/https://devopsaitoolkit.com/blog/mocking-providers-in-terraform-tests-for-fast-offline-runs/Use mock_provider and override_resource/override_data/override_module in terraform test to write fast offline unit tests, with AI scaffolds reviewed by humans.Wed, 17 Jun 2026 00:00:00 GMTterraformterraformtestingmock-providerciaihttps://devopsaitoolkit.com/blog/most-common-linux-server-problems-and-fixes/https://devopsaitoolkit.com/blog/most-common-linux-server-problems-and-fixes/The most common Linux server problems and how to fix them: disk full, high load, OOM killer, SSH lockout, DNS failures, and more — with real diagnostic commands.Wed, 17 Jun 2026 00:00:00 GMTlinux-adminslinuxtroubleshootingsysadmindevopsserverhttps://devopsaitoolkit.com/blog/multi-workspace-slack-app-oauth-and-token-storage/https://devopsaitoolkit.com/blog/multi-workspace-slack-app-oauth-and-token-storage/Ship a Slack app multiple workspaces can install: the OAuth 2.0 flow, state validation, per-team token storage, and rotation. AI scaffolds it; you secure it.Wed, 17 Jun 2026 00:00:00 GMTslackslackchatopsoauthsecurityhttps://devopsaitoolkit.com/blog/native-sidecar-containers-vs-init-containers-in-kubernetes/https://devopsaitoolkit.com/blog/native-sidecar-containers-vs-init-containers-in-kubernetes/Kubernetes native sidecars solve the old problems of pods that never finish and proxies that die too early. Learn how restartPolicy Always on init containers changes the game.Wed, 17 Jun 2026 00:00:00 GMTkubernetes-helmkubernetessidecarsinit-containerspodslifecyclehttps://devopsaitoolkit.com/blog/nova-host-aggregates-numa-cpu-pinning-openstack/https://devopsaitoolkit.com/blog/nova-host-aggregates-numa-cpu-pinning-openstack/Performance-sensitive workloads need NUMA awareness and CPU pinning in Nova. Here's how to configure host aggregates, flavors, and pinning, debugged with AI help.Wed, 17 Jun 2026 00:00:00 GMTopenstackopenstacknovanumacpu-pinningperformancehttps://devopsaitoolkit.com/blog/openstack-neutron-qos-rate-limiting/https://devopsaitoolkit.com/blog/openstack-neutron-qos-rate-limiting/Neutron QoS policies cap bandwidth, guarantee minimums, and mark DSCP per port. Here's how to apply and debug OpenStack QoS without throttling the wrong tenant, with AI help.Wed, 17 Jun 2026 00:00:00 GMTopenstackopenstackneutronqosnetworkingbandwidthhttps://devopsaitoolkit.com/blog/openstack-telemetry-alarming-ceilometer-aodh/https://devopsaitoolkit.com/blog/openstack-telemetry-alarming-ceilometer-aodh/Ceilometer collects, Gnocchi stores, and Aodh alarms. Here's how to wire OpenStack telemetry end to end and debug alarms that never fire, with AI help.Wed, 17 Jun 2026 00:00:00 GMTopenstackopenstackceilometeraodhgnocchitelemetryhttps://devopsaitoolkit.com/blog/orchestrating-nfv-with-openstack-tacker/https://devopsaitoolkit.com/blog/orchestrating-nfv-with-openstack-tacker/Tacker is OpenStack's VNF manager and NFV orchestrator. Here's how to onboard VNF packages, instantiate VNFs, and debug failed deployments with AI assistance.Wed, 17 Jun 2026 00:00:00 GMTopenstackopenstacktackernfvvnforchestrationhttps://devopsaitoolkit.com/blog/orchestrating-rolling-deploys-with-ansible-delegate-to-and-serial/https://devopsaitoolkit.com/blog/orchestrating-rolling-deploys-with-ansible-delegate-to-and-serial/Orchestrate zero-downtime rolling deploys in Ansible with serial batching, delegate_to LB drain, run_once migrations and health checks, AI-drafted, human-reviewed.Wed, 17 Jun 2026 00:00:00 GMTansibleiacansibleaiorchestrationdeploymentshttps://devopsaitoolkit.com/blog/parsing-terraform-plan-json-for-ai-assisted-review/https://devopsaitoolkit.com/blog/parsing-terraform-plan-json-for-ai-assisted-review/Export terraform plan JSON, then use jq plus AI to summarize and risk-score changes in CI, with humans on every apply and never handing over state or creds.Wed, 17 Jun 2026 00:00:00 GMTterraformterraformplanjqciaihttps://devopsaitoolkit.com/blog/power-automate-alm-ship-teams-flows-across-environments/https://devopsaitoolkit.com/blog/power-automate-alm-ship-teams-flows-across-environments/Hand-built flows in production are a liability. Here's solution-based ALM for Power Automate: environments, managed solutions, connection references, and pipelines.Wed, 17 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamspower-automatealmpower-platformci-cdhttps://devopsaitoolkit.com/blog/preflight-checks-in-ansible-with-assert-and-fail/https://devopsaitoolkit.com/blog/preflight-checks-in-ansible-with-assert-and-fail/Use AI to draft assert/fail pre-flight guards for Ansible playbooks so they refuse to run when vars are missing or the target is wrong, each change human-reviewed.Wed, 17 Jun 2026 00:00:00 GMTansibleiacansibleaivalidationsafetyhttps://devopsaitoolkit.com/blog/progressive-delivery-in-gitlab-ci-canary-and-blue-green-deploys/https://devopsaitoolkit.com/blog/progressive-delivery-in-gitlab-ci-canary-and-blue-green-deploys/Big-bang deploys are how you get paged. Here is how I build canary and blue-green rollouts in GitLab CI, with AI drafting the weight-shifting logic safely.Wed, 17 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cddeploymentskuberneteshttps://devopsaitoolkit.com/blog/prometheus-federation-vs-remote-write-which-and-when/https://devopsaitoolkit.com/blog/prometheus-federation-vs-remote-write-which-and-when/Federation aggregates recording-rule outputs across teams; remote-write centralizes raw series. Learn which Prometheus pattern fits, with real configs.Wed, 17 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusfederationremote-writescalingsrehttps://devopsaitoolkit.com/blog/prometheus-tsdb-internals-blocks-compaction-retention/https://devopsaitoolkit.com/blog/prometheus-tsdb-internals-blocks-compaction-retention/A deep dive into Prometheus TSDB internals — the head block, WAL, on-disk blocks, compaction and retention — with PromQL, flags, and disk sizing tips.Wed, 17 Jun 2026 00:00:00 GMTprometheus-monitoringprometheustsdbstoragecompactionsrehttps://devopsaitoolkit.com/blog/promql-rate-irate-increase-when-each-one-lies/https://devopsaitoolkit.com/blog/promql-rate-irate-increase-when-each-one-lies/A working SRE's guide to PromQL rate, irate, and increase on counters: extrapolation, lookback gotchas, when each misleads, and reviewing AI-drafted queries.Wed, 17 Jun 2026 00:00:00 GMTprometheus-monitoringprometheuspromqlcounterssrehttps://devopsaitoolkit.com/blog/promql-subqueries-and-over-time-for-trend-analysis/https://devopsaitoolkit.com/blog/promql-subqueries-and-over-time-for-trend-analysis/A practical guide to PromQL subqueries and the _over_time family for spotting trends, slow leaks, and daily peaks, plus why recording rules often win.Wed, 17 Jun 2026 00:00:00 GMTprometheus-monitoringprometheuspromqlsubqueriestrendssrehttps://devopsaitoolkit.com/blog/protecting-responder-wellbeing-after-a-major-incident/https://devopsaitoolkit.com/blog/protecting-responder-wellbeing-after-a-major-incident/The incident ends but the toll on responders doesn't. How to protect on-call mental health after major incidents, with AI handling busywork so humans get rest.Wed, 17 Jun 2026 00:00:00 GMTincident-responseincident-responseon-callcultureburnouthttps://devopsaitoolkit.com/blog/provision-and-deploy-teams-apps-with-teams-toolkit-and-bicep/https://devopsaitoolkit.com/blog/provision-and-deploy-teams-apps-with-teams-toolkit-and-bicep/Scaffolding a Teams app is easy; getting its Azure infra reproducible is not. Here's the Teams Toolkit provision/deploy lifecycle backed by Bicep, in CI.Wed, 17 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsteams-toolkitbicepazureinfrastructure-as-codehttps://devopsaitoolkit.com/blog/publishing-versioned-gitlab-ci-cd-catalog-components/https://devopsaitoolkit.com/blog/publishing-versioned-gitlab-ci-cd-catalog-components/Stop copy-pasting pipeline YAML between projects. Here is how I build, version, and publish reusable GitLab CI/CD Catalog components, with AI on boilerplate.Wed, 17 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdcomponentsaihttps://devopsaitoolkit.com/blog/python-dataclasses-for-modeling-ops-data-cleanly/https://devopsaitoolkit.com/blog/python-dataclasses-for-modeling-ops-data-cleanly/Stop passing dicts and tuples around your automation. Python dataclasses give your ops scripts typed, self-documenting records with almost no boilerplate.Wed, 17 Jun 2026 00:00:00 GMTbash-python-automationpythonbashdata-modelinghttps://devopsaitoolkit.com/blog/python-pathlib-for-filesystem-automation-the-modern-way/https://devopsaitoolkit.com/blog/python-pathlib-for-filesystem-automation-the-modern-way/Stop gluing paths with string concatenation and os.path. Here is how pathlib makes filesystem automation cleaner, safer, and far less error-prone in ops.Wed, 17 Jun 2026 00:00:00 GMTbash-python-automationpythonbashfilesystemhttps://devopsaitoolkit.com/blog/python-subprocess-done-right-shlex-timeouts-and-check/https://devopsaitoolkit.com/blog/python-subprocess-done-right-shlex-timeouts-and-check/Most subprocess bugs come from shell=True, missing timeouts, and ignored exit codes. Here is how I run external commands from Python ops scripts safely.Wed, 17 Jun 2026 00:00:00 GMTbash-python-automationpythonbashsecurityhttps://devopsaitoolkit.com/blog/ransomware-resilient-backups-immutability-and-recovery-drills/https://devopsaitoolkit.com/blog/ransomware-resilient-backups-immutability-and-recovery-drills/Build immutable, air-gapped backups with S3 Object Lock and restic append-only repos, plus recovery drills and mass-encryption detection to survive ransomware.Wed, 17 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningbackupsransomwareresiliencehttps://devopsaitoolkit.com/blog/reaction-driven-slack-automations-for-ops/https://devopsaitoolkit.com/blog/reaction-driven-slack-automations-for-ops/Trigger ops workflows from Slack reactions: ack alerts with ✅, escalate with 🚨, file tickets with 📝. AI scaffolds the handlers; you review the guardrails.Wed, 17 Jun 2026 00:00:00 GMTslackslackchatopsevents-apiautomationhttps://devopsaitoolkit.com/blog/replacing-setuid-with-linux-capabilities/https://devopsaitoolkit.com/blog/replacing-setuid-with-linux-capabilities/Swap dangerous setuid root binaries for narrow Linux capabilities. Use setcap, getcap, getpcaps and systemd to grant only the privilege a process needs.Wed, 17 Jun 2026 00:00:00 GMTlinux-adminslinuxcapabilitiessecurityhardeninghttps://devopsaitoolkit.com/blog/resource-reservation-with-openstack-blazar/https://devopsaitoolkit.com/blog/resource-reservation-with-openstack-blazar/Blazar adds reservations to OpenStack so users can book hosts and instances ahead of time. Here's how to set up leases, debug allocation failures, and use AI to plan capacity.Wed, 17 Jun 2026 00:00:00 GMTopenstackopenstackblazarreservationschedulingcapacityhttps://devopsaitoolkit.com/blog/retiring-resources-safely-with-the-terraform-removed-block/https://devopsaitoolkit.com/blog/retiring-resources-safely-with-the-terraform-removed-block/Use the Terraform removed block (1.7+) to declaratively drop resources from state without destroying real infrastructure. The modern replacement for state rm.Wed, 17 Jun 2026 00:00:00 GMTterraformterraformstaterefactoringremovedaihttps://devopsaitoolkit.com/blog/risk-tiered-approval-gates-with-policy-as-code/https://devopsaitoolkit.com/blog/risk-tiered-approval-gates-with-policy-as-code/Not every automated action needs a human, and not every one should run unattended. Tier approvals by risk with OPA policy-as-code so the gate fits the danger.Wed, 17 Jun 2026 00:00:00 GMTautomationautomationpolicy-as-codeopaapproval-gatesgovernancehttps://devopsaitoolkit.com/blog/rotating-ansible-vault-keys-at-scale-with-ai-assistance/https://devopsaitoolkit.com/blog/rotating-ansible-vault-keys-at-scale-with-ai-assistance/Rekey Ansible Vault across dozens of files and environments at scale. Let AI plan and script the rotation while humans hold the keys and review every change.Wed, 17 Jun 2026 00:00:00 GMTansibleiacansiblesecurityvaultsecretshttps://devopsaitoolkit.com/blog/running-a-monthly-sev-review-board-with-ai/https://devopsaitoolkit.com/blog/running-a-monthly-sev-review-board-with-ai/How to run a recurring SEV review board that spots cross-incident patterns, with AI synthesizing themes across postmortems while humans own the decisions.Wed, 17 Jun 2026 00:00:00 GMTincident-responseincident-responsepostmortemsreprocesshttps://devopsaitoolkit.com/blog/running-containers-with-openstack-zun/https://devopsaitoolkit.com/blog/running-containers-with-openstack-zun/Zun runs containers as first-class OpenStack resources without a Kubernetes layer. Here's how to deploy, network, and debug Zun capsules with AI assistance.Wed, 17 Jun 2026 00:00:00 GMTopenstackopenstackzuncontainerskuryrdeploymenthttps://devopsaitoolkit.com/blog/running-incident-tabletop-exercises-that-build-real-skill/https://devopsaitoolkit.com/blog/running-incident-tabletop-exercises-that-build-real-skill/Tabletop exercises build incident response muscle without touching production. Here's how to run them well and use AI to generate realistic injects and scenarios.Wed, 17 Jun 2026 00:00:00 GMTincident-responseincident-responsetrainingprocesson-callhttps://devopsaitoolkit.com/blog/safer-targeted-ansible-runs-with-tags-and-limit/https://devopsaitoolkit.com/blog/safer-targeted-ansible-runs-with-tags-and-limit/Use AI to add a clean tagging strategy, then run targeted Ansible with --tags, --limit and --check for tight blast-radius control, every change human-reviewed.Wed, 17 Jun 2026 00:00:00 GMTansibleiacansibleaitagssafetyhttps://devopsaitoolkit.com/blog/saga-pattern-compensating-transactions-for-ops-automation/https://devopsaitoolkit.com/blog/saga-pattern-compensating-transactions-for-ops-automation/Multi-step automation has no rollback button. Here's how the saga pattern and compensating transactions let your workflows unwind cleanly when step four fails.Wed, 17 Jun 2026 00:00:00 GMTautomationautomationsagaorchestrationreliabilitysrehttps://devopsaitoolkit.com/blog/scaling-prometheus-scrape-sharding-and-agent-mode/https://devopsaitoolkit.com/blog/scaling-prometheus-scrape-sharding-and-agent-mode/Scale Prometheus scraping horizontally with functional sharding, hashmod scrape sharding, and Agent Mode. Real relabel configs, agent-mode flags, and tradeoffs.Wed, 17 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusshardingagent-modescalingsrehttps://devopsaitoolkit.com/blog/scanning-terraform-with-checkov-and-tfsec-then-fixing-with-ai/https://devopsaitoolkit.com/blog/scanning-terraform-with-checkov-and-tfsec-then-fixing-with-ai/Scan Terraform with Checkov and tfsec, emit SARIF in CI, manage skip comments, and let AI triage the findings to draft remediations a human always reviews.Wed, 17 Jun 2026 00:00:00 GMTterraformterraformsecuritycheckovtfsecaihttps://devopsaitoolkit.com/blog/securing-slack-connect-shared-channels-for-ops/https://devopsaitoolkit.com/blog/securing-slack-connect-shared-channels-for-ops/Harden Slack Connect shared channels for ops: scope bots correctly, gate external members, and audit cross-org events with AI as a fast junior you review.Wed, 17 Jun 2026 00:00:00 GMTslackslackchatopssecurityslack-connecthttps://devopsaitoolkit.com/blog/sharing-files-and-snippets-from-slack-ops-bots/https://devopsaitoolkit.com/blog/sharing-files-and-snippets-from-slack-ops-bots/Use Slack's external file upload flow to attach logs, diffs, and reports to ops messages. AI scaffolds the multi-step upload; you review redaction first.Wed, 17 Jun 2026 00:00:00 GMTslackslackchatopsweb-apifileshttps://devopsaitoolkit.com/blog/slack-app-home-tab-as-an-ops-control-panel/https://devopsaitoolkit.com/blog/slack-app-home-tab-as-an-ops-control-panel/Use the Slack App Home tab to give each engineer a private ops dashboard: on-call status, open incidents, and actions. AI scaffolds the views; you review them.Wed, 17 Jun 2026 00:00:00 GMTslackslackchatopsblock-kitapp-homehttps://devopsaitoolkit.com/blog/slack-link-unfurling-for-internal-ops-tools/https://devopsaitoolkit.com/blog/slack-link-unfurling-for-internal-ops-tools/Build a Slack link-unfurling bot that turns internal dashboard and runbook URLs into rich Block Kit previews, with AI scaffolding you review before shipping.Wed, 17 Jun 2026 00:00:00 GMTslackslackchatopsblock-kitevents-apihttps://devopsaitoolkit.com/blog/slack-web-api-pagination-cursors-for-ops-bots/https://devopsaitoolkit.com/blog/slack-web-api-pagination-cursors-for-ops-bots/Master Slack Web API cursor pagination so your ops bot never silently drops members, messages, or channels. AI scaffolds the loop; you verify it's complete.Wed, 17 Jun 2026 00:00:00 GMTslackslackchatopsweb-apireliabilityhttps://devopsaitoolkit.com/blog/surgical-terraform-operations-target-replace-and-refresh-only/https://devopsaitoolkit.com/blog/surgical-terraform-operations-target-replace-and-refresh-only/Use terraform -target, -replace, and -refresh-only as careful escape hatches, not workflow. Let AI propose the minimal safe op while a human reviews every plan.Wed, 17 Jun 2026 00:00:00 GMTterraformterraformclistateoperationsaihttps://devopsaitoolkit.com/blog/taming-ansible-lint-with-ai-from-warnings-to-clean-runs/https://devopsaitoolkit.com/blog/taming-ansible-lint-with-ai-from-warnings-to-clean-runs/Use AI to triage a noisy ansible-lint report, write a sane .ansible-lint config, fix rule violations, and wire it into CI, with human review and dry runs.Wed, 17 Jun 2026 00:00:00 GMTansibleiacansibleaiansible-lintcihttps://devopsaitoolkit.com/blog/taming-gitlab-pipeline-concurrency-resource-groups-and-interruptible/https://devopsaitoolkit.com/blog/taming-gitlab-pipeline-concurrency-resource-groups-and-interruptible/Two deploys racing to prod, stale pipelines burning runner minutes: concurrency bugs are silent. Here is how resource_group and interruptible fix them.Wed, 17 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdconcurrencyperformancehttps://devopsaitoolkit.com/blog/taming-sensitive-values-and-outputs-in-terraform/https://devopsaitoolkit.com/blog/taming-sensitive-values-and-outputs-in-terraform/How Terraform sensitive variables and outputs work, the way sensitivity propagates through expressions, the nonsensitive() footgun, and AI-assisted leak audits.Wed, 17 Jun 2026 00:00:00 GMTterraformterraformsecuritysensitiveoutputsaihttps://devopsaitoolkit.com/blog/temporal-signals-and-human-in-the-loop-workflows/https://devopsaitoolkit.com/blog/temporal-signals-and-human-in-the-loop-workflows/Durable workflows that wait days for an approval without burning a thread. How Temporal signals, queries, and timers build safe human-in-the-loop automation.Wed, 17 Jun 2026 00:00:00 GMTautomationautomationtemporalorchestrationapproval-gatessrehttps://devopsaitoolkit.com/blog/top-25-gitlab-cicd-pipeline-mistakes/https://devopsaitoolkit.com/blog/top-25-gitlab-cicd-pipeline-mistakes/The top 25 GitLab CI/CD pipeline mistakes that hurt security, cost, and reliability — with real .gitlab-ci.yml fixes you can copy into your repo today.Wed, 17 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdpipelinesdevopsmistakeshttps://devopsaitoolkit.com/blog/transactional-outbox-pattern-for-reliable-event-automation/https://devopsaitoolkit.com/blog/transactional-outbox-pattern-for-reliable-event-automation/Your automation wrote to the database but the event publish failed — now downstream is out of sync. The outbox pattern makes state changes and events atomic.Wed, 17 Jun 2026 00:00:00 GMTautomationautomationoutboxevent-drivenmessagingreliabilityhttps://devopsaitoolkit.com/blog/triaging-source-dependency-vulnerabilities-with-osv-scanner/https://devopsaitoolkit.com/blog/triaging-source-dependency-vulnerabilities-with-osv-scanner/Scan source lockfiles with OSV-Scanner, triage findings by reachability and fix availability, and suppress non-exploitable noise with VEX to keep CI honest.Wed, 17 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningdependenciesvulnerability-managementsupply-chainhttps://devopsaitoolkit.com/blog/troubleshooting-swift-object-storage-openstack/https://devopsaitoolkit.com/blog/troubleshooting-swift-object-storage-openstack/Swift looks simple until a ring goes lopsided or replication stalls. Here's how I diagnose 503s, unbalanced rings, and stuck object replication in OpenStack Swift.Wed, 17 Jun 2026 00:00:00 GMTopenstackopenstackswiftobject-storagereplicationtroubleshootinghttps://devopsaitoolkit.com/blog/understanding-linux-namespaces-with-unshare-and-nsenter/https://devopsaitoolkit.com/blog/understanding-linux-namespaces-with-unshare-and-nsenter/Explore Linux namespaces (PID, net, mount, user) with unshare and nsenter to demystify container isolation, with AI help acting as a fast junior pair.Wed, 17 Jun 2026 00:00:00 GMTlinux-adminslinuxnamespacescontainersisolationhttps://devopsaitoolkit.com/blog/using-ai-to-troubleshoot-kubernetes-clusters-faster/https://devopsaitoolkit.com/blog/using-ai-to-troubleshoot-kubernetes-clusters-faster/A copy-paste workflow to troubleshoot Kubernetes clusters faster with AI: capture commands, prompts, and example answers for CrashLoopBackOff, OOMKilled, and more.Wed, 17 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesaitroubleshootingk8ssrehttps://devopsaitoolkit.com/blog/validate-your-teams-app-manifest-in-ci-before-it-breaks/https://devopsaitoolkit.com/blog/validate-your-teams-app-manifest-in-ci-before-it-breaks/A bad manifest fails at upload, in front of everyone. Here's how to lint, schema-validate, and version your Teams app manifest in CI so bad packages never ship.Wed, 17 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsmanifestci-cdteams-toolkitvalidationhttps://devopsaitoolkit.com/blog/watching-files-and-directories-in-python-with-watchdog/https://devopsaitoolkit.com/blog/watching-files-and-directories-in-python-with-watchdog/React to config changes, new log lines, and dropped files in real time. A practical guide to the watchdog library for event-driven Python automation.Wed, 17 Jun 2026 00:00:00 GMTbash-python-automationpythonbashautomationhttps://devopsaitoolkit.com/blog/watching-filesystem-events-with-inotify-on-linux/https://devopsaitoolkit.com/blog/watching-filesystem-events-with-inotify-on-linux/Learn to react to filesystem changes with inotifywait, inotifywatch, and incron on Linux, plus systemd path units and AI help to write the glue scripts.Wed, 17 Jun 2026 00:00:00 GMTlinux-adminslinuxinotifyautomationmonitoringhttps://devopsaitoolkit.com/blog/webhook-fan-out-and-dedupe-patterns-for-automation/https://devopsaitoolkit.com/blog/webhook-fan-out-and-dedupe-patterns-for-automation/One inbound webhook often needs to trigger five downstream actions — without double-firing on redeliveries. Here's how to fan out and dedupe webhooks reliably.Wed, 17 Jun 2026 00:00:00 GMTautomationautomationwebhooksevent-drivenmessagingreliabilityhttps://devopsaitoolkit.com/blog/what-does-a-senior-devops-engineer-do-every-day/https://devopsaitoolkit.com/blog/what-does-a-senior-devops-engineer-do-every-day/What does a senior DevOps engineer do every day? A realistic day-in-the-life breakdown of on-call, IaC, CI/CD, observability, mentoring, and AI-assisted work.Wed, 17 Jun 2026 00:00:00 GMTautomationdevopscareersreplatform-engineeringday-in-the-lifehttps://devopsaitoolkit.com/blog/writing-bash-completion-scripts-with-complete-and-compgen/https://devopsaitoolkit.com/blog/writing-bash-completion-scripts-with-complete-and-compgen/Give your ops CLIs tab completion for subcommands, flags, and dynamic values. A practical guide to complete and compgen, with AI doing the boilerplate.Wed, 17 Jun 2026 00:00:00 GMTbash-python-automationbashpythonclihttps://devopsaitoolkit.com/blog/writing-bulletproof-terraform-variable-validation-with-ai/https://devopsaitoolkit.com/blog/writing-bulletproof-terraform-variable-validation-with-ai/Use AI to draft strong Terraform variable validation blocks that fail fast at plan time, then have a human review every condition before you ever apply.Wed, 17 Jun 2026 00:00:00 GMTterraformterraformvariablesvalidationaiiachttps://devopsaitoolkit.com/blog/writing-custom-ansible-modules-in-python-with-ai/https://devopsaitoolkit.com/blog/writing-custom-ansible-modules-in-python-with-ai/Use AI to draft a custom Ansible Python module with proper check_mode, argument_spec, no_log secrets and real idempotency, then have a human review every line.Wed, 17 Jun 2026 00:00:00 GMTansibleiacansibleaipythonmoduleshttps://devopsaitoolkit.com/blog/writing-external-rca-reports-for-enterprise-customers-with-ai/https://devopsaitoolkit.com/blog/writing-external-rca-reports-for-enterprise-customers-with-ai/Enterprise customers demand RCA reports after outages. Learn how to write a credible external root cause analysis fast, with AI drafting and humans owning every word.Wed, 17 Jun 2026 00:00:00 GMTpostmortemsincident-responsepostmortemcommunicationrcahttps://devopsaitoolkit.com/blog/ai-alert-triage-bot-routing-slack-channels/https://devopsaitoolkit.com/blog/ai-alert-triage-bot-routing-slack-channels/Build a Slack bot that uses an LLM to classify monitoring alerts by severity, service, and owner, then routes them to the right channel — with human-in-the-loop review.Tue, 16 Jun 2026 00:00:00 GMTslackslackchatopsalertingincident-responseaihttps://devopsaitoolkit.com/blog/ai-assisted-ansible-role-refactors-without-breaking-prod/https://devopsaitoolkit.com/blog/ai-assisted-ansible-role-refactors-without-breaking-prod/Refactoring a tangled Ansible role is risky. Here's how I use AI to split, rename, and modernize roles while keeping behavior identical and prod safe.Tue, 16 Jun 2026 00:00:00 GMTansibleiacansibleairefactoringroleshttps://devopsaitoolkit.com/blog/ai-assisted-argparse-cli-design-for-python-ops-tools/https://devopsaitoolkit.com/blog/ai-assisted-argparse-cli-design-for-python-ops-tools/Design clean, discoverable argparse CLIs with AI help — subcommands, sane defaults, dry-run flags, and validation that stops bad invocations before they run on prod.Tue, 16 Jun 2026 00:00:00 GMTbash-python-automationpythonbashcliargparsehttps://devopsaitoolkit.com/blog/ai-assisted-block-kit-design-faster-slack-ux/https://devopsaitoolkit.com/blog/ai-assisted-block-kit-design-faster-slack-ux/Use Claude or ChatGPT to draft and iterate Block Kit JSON for ops messages, run a tight validation loop, dodge common AI mistakes, and review before shipping.Tue, 16 Jun 2026 00:00:00 GMTslackslackchatopsblock-kitaihttps://devopsaitoolkit.com/blog/ai-assisted-cron-and-scheduled-job-cleanup/https://devopsaitoolkit.com/blog/ai-assisted-cron-and-scheduled-job-cleanup/Every org has a graveyard of crontabs nobody understands. Here's how to use AI to inventory, explain, and safely migrate scheduled jobs without breaking prod.Tue, 16 Jun 2026 00:00:00 GMTautomationautomationcronkubernetesaicleanuphttps://devopsaitoolkit.com/blog/ai-assisted-dynamic-child-pipelines-for-gitlab-monorepos/https://devopsaitoolkit.com/blog/ai-assisted-dynamic-child-pipelines-for-gitlab-monorepos/Monorepos need pipelines that build only what changed. Here's how I use AI to write the generator script that emits GitLab child pipeline YAML on the fly.Tue, 16 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdaimonorepochild-pipelineshttps://devopsaitoolkit.com/blog/ai-assisted-firewall-rule-reviews-for-nftables/https://devopsaitoolkit.com/blog/ai-assisted-firewall-rule-reviews-for-nftables/A firewall ruleset is only as good as your ability to read it. Here's how I use AI to audit nftables rules for overly broad allows, shadowed rules, and default-allow gaps.Tue, 16 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningnftablesfirewallaihttps://devopsaitoolkit.com/blog/ai-assisted-gitlab-ci-yaml-refactors/https://devopsaitoolkit.com/blog/ai-assisted-gitlab-ci-yaml-refactors/A 600-line .gitlab-ci.yml is a refactor minefield. Here's how I use AI to flatten duplication with extends, anchors, and includes without breaking the pipeline.Tue, 16 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdairefactoringyamlhttps://devopsaitoolkit.com/blog/ai-assisted-glance-image-boot-failures-openstack/https://devopsaitoolkit.com/blog/ai-assisted-glance-image-boot-failures-openstack/Why instances won't boot from a Glance image — disk formats, image properties, virtio drivers, cloud-init — and how AI speeds up triage without your cloud.Tue, 16 Jun 2026 00:00:00 GMTopenstackopenstackglancenovaimageshttps://devopsaitoolkit.com/blog/ai-assisted-keystone-token-policy-debugging/https://devopsaitoolkit.com/blog/ai-assisted-keystone-token-policy-debugging/A practical walkthrough of debugging Keystone tokens, scopes, role assignments, and policy.yaml RBAC with AI help — and why the AI never touches your admin token.Tue, 16 Jun 2026 00:00:00 GMTopenstackopenstackkeystonerbacidentityhttps://devopsaitoolkit.com/blog/ai-assisted-neutron-security-group-port-binding/https://devopsaitoolkit.com/blog/ai-assisted-neutron-security-group-port-binding/Tracing binding_failed ports, ML2 agent gaps, and silent security group drops in Neutron, with AI as a fast assistant that never touches production credentials.Tue, 16 Jun 2026 00:00:00 GMTopenstackopenstackneutronnetworkingsecurity-groupshttps://devopsaitoolkit.com/blog/ai-assisted-on-call-handoffs-that-dont-drop-context/https://devopsaitoolkit.com/blog/ai-assisted-on-call-handoffs-that-dont-drop-context/Most on-call handoffs lose half the context the moment the shift changes. Here's how to use AI to write a brief the next person can actually act on.Tue, 16 Jun 2026 00:00:00 GMTincident-responseincident-responseon-callaihandoffsrehttps://devopsaitoolkit.com/blog/ai-assisted-promql-histogram-quantile-latency/https://devopsaitoolkit.com/blog/ai-assisted-promql-histogram-quantile-latency/histogram_quantile trips up everyone. How I use AI to write correct p95/p99 latency queries and avoid the aggregation traps that quietly fake your SLOs.Tue, 16 Jun 2026 00:00:00 GMTprometheus-monitoringprometheuspromqlhistogramlatencyaislohttps://devopsaitoolkit.com/blog/ai-assisted-rbac-least-privilege-audits/https://devopsaitoolkit.com/blog/ai-assisted-rbac-least-privilege-audits/Kubernetes RBAC sprawls until everything is cluster-admin. Here's how I use AI to audit Roles and Bindings for least privilege without breaking workloads.Tue, 16 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesrbacsecurityaiaudithttps://devopsaitoolkit.com/blog/ai-assisted-recording-rules-from-slow-queries/https://devopsaitoolkit.com/blog/ai-assisted-recording-rules-from-slow-queries/Heavy PromQL queries hammer Prometheus and lag dashboards. How I use AI to find expensive expressions and refactor them into correct, fast recording rules.Tue, 16 Jun 2026 00:00:00 GMTprometheus-monitoringprometheuspromqlrecording-rulesaiperformancehttps://devopsaitoolkit.com/blog/ai-assisted-runbook-selection-routing-alerts-to-the-right-fix/https://devopsaitoolkit.com/blog/ai-assisted-runbook-selection-routing-alerts-to-the-right-fix/An alert fires — which of your 200 runbooks applies? Use embeddings and an LLM classifier to route alerts to the right fix, with a human confirming first.Tue, 16 Jun 2026 00:00:00 GMTautomationautomationrunbooksaiincident-responsealertinghttps://devopsaitoolkit.com/blog/ai-assisted-secret-handling-in-bash-and-python-automation/https://devopsaitoolkit.com/blog/ai-assisted-secret-handling-in-bash-and-python-automation/AI will hardcode tokens and log secrets if you let it. Learn safe patterns for env vars, secrets managers, and redaction in bash and Python automation scripts.Tue, 16 Jun 2026 00:00:00 GMTbash-python-automationbashpythonsecretssecurityhttps://devopsaitoolkit.com/blog/ai-assisted-sudoers-least-privilege-audits/https://devopsaitoolkit.com/blog/ai-assisted-sudoers-least-privilege-audits/A sloppy sudoers file is a privilege-escalation waiting to happen. Here's how I use AI to audit sudo rules for wildcards, NOPASSWD traps, and GTFOBins-style escape hatches before attackers do.Tue, 16 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningsudolinuxaihttps://devopsaitoolkit.com/blog/ai-digests-for-noisy-teams-alert-channels/https://devopsaitoolkit.com/blog/ai-digests-for-noisy-teams-alert-channels/When your Teams alerting channel scrolls faster than anyone can read, an LLM-summarized digest card restores signal. Here's how to build one with Graph and a bot.Tue, 16 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsalertinggraph-apiaiobservabilityhttps://devopsaitoolkit.com/blog/ai-drafted-postmortems-from-slack-incident-channels/https://devopsaitoolkit.com/blog/ai-drafted-postmortems-from-slack-incident-channels/Pull an incident channel's history, summarize the timeline, extract action items, and let AI draft a blameless postmortem the incident commander owns and edits before sharing.Tue, 16 Jun 2026 00:00:00 GMTslackslackchatopspostmortemaihttps://devopsaitoolkit.com/blog/ai-for-gitlab-ci-parallel-and-matrix-jobs/https://devopsaitoolkit.com/blog/ai-for-gitlab-ci-parallel-and-matrix-jobs/GitLab parallel and matrix jobs multiply fast and get expensive. Here's how I use AI to generate matrices that test what matters without runner sprawl.Tue, 16 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdaimatrixperformancehttps://devopsaitoolkit.com/blog/ai-generated-error-handling-for-python-automation-scripts/https://devopsaitoolkit.com/blog/ai-generated-error-handling-for-python-automation-scripts/AI loves bare except clauses and swallowed errors. Learn to prompt for precise exception handling, useful failure messages, and clean exits in Python automation.Tue, 16 Jun 2026 00:00:00 GMTbash-python-automationpythonbasherror-handlingexceptionshttps://devopsaitoolkit.com/blog/ai-generated-on-call-handoff-summaries-slack/https://devopsaitoolkit.com/blog/ai-generated-on-call-handoff-summaries-slack/Draft end-of-shift on-call handoff summaries with AI: pull open incidents and threads, summarize, format as Block Kit, and let the engineer review and edit before posting.Tue, 16 Jun 2026 00:00:00 GMTslackslackchatopson-callaihttps://devopsaitoolkit.com/blog/ai-generated-remediation-code-from-incidents/https://devopsaitoolkit.com/blog/ai-generated-remediation-code-from-incidents/Turn a manual incident fix into reusable automation: feed AI the timeline, generate idempotent code, review it as a human, dry-run it, and merge via PR.Tue, 16 Jun 2026 00:00:00 GMTautomationautomationincident-responseansibleaicode-reviewhttps://devopsaitoolkit.com/blog/ai-prompts-for-gitlab-ci-rules-and-workflow/https://devopsaitoolkit.com/blog/ai-prompts-for-gitlab-ci-rules-and-workflow/GitLab CI rules and workflow logic is where pipelines silently misbehave. Here are the AI prompts I use to get correct rules without the duplicate-pipeline bug.Tue, 16 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdairulespromptshttps://devopsaitoolkit.com/blog/ai-reviewed-alert-copy-clearer-slack-notifications/https://devopsaitoolkit.com/blog/ai-reviewed-alert-copy-clearer-slack-notifications/Use AI to rewrite noisy automated Slack alert copy into clear, actionable messages at template time, with before/after Block Kit examples and human approval.Tue, 16 Jun 2026 00:00:00 GMTslackslackchatopsalertingaihttps://devopsaitoolkit.com/blog/audit-teams-webhook-and-connector-security-with-ai/https://devopsaitoolkit.com/blog/audit-teams-webhook-and-connector-security-with-ai/Old Office 365 connectors and incoming webhooks are leaky by design. Use AI to inventory them, spot the risky ones, and plan a migration to Workflows — safely.Tue, 16 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamssecuritywebhooksconnectorsaihttps://devopsaitoolkit.com/blog/auditing-an-inherited-linux-server/https://devopsaitoolkit.com/blog/auditing-an-inherited-linux-server/Just inherited a mystery Linux server with no docs? Use this recon playbook plus AI to inventory services, cron jobs, users, and risks before you change a thing.Tue, 16 Jun 2026 00:00:00 GMTlinux-adminslinuxauditrecondocumentationsysadminhttps://devopsaitoolkit.com/blog/auditing-github-actions-workflows-for-security-with-ai/https://devopsaitoolkit.com/blog/auditing-github-actions-workflows-for-security-with-ai/CI pipelines run with privileged tokens and pull untrusted code. Here's how I use AI to audit GitHub Actions workflows for injection, token over-scope, and unpinned actions before they ship.Tue, 16 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningci-cdgithub-actionsaihttps://devopsaitoolkit.com/blog/auditing-pam-and-password-policy-with-ai/https://devopsaitoolkit.com/blog/auditing-pam-and-password-policy-with-ai/PAM controls who gets in and how. Here's how I use AI to audit pam.d stacks and password policy for weak lockout, missing MFA hooks, and silent authentication bypasses.Tue, 16 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeninglinuxauthenticationaihttps://devopsaitoolkit.com/blog/automating-systemd-unit-hardening-with-ai/https://devopsaitoolkit.com/blog/automating-systemd-unit-hardening-with-ai/Use systemd's sandboxing directives to lock down services, read systemd-analyze security scores, and let AI draft hardening overrides you review before applying.Tue, 16 Jun 2026 00:00:00 GMTlinux-adminslinuxsystemdsecurityhardeningsysadminhttps://devopsaitoolkit.com/blog/blast-radius-scoping-for-ai-driven-automation/https://devopsaitoolkit.com/blog/blast-radius-scoping-for-ai-driven-automation/A deep dive on limiting what AI-driven automation can touch: namespace and label scoping, allow-lists, resource tiers, least-privilege RBAC, and policy guards.Tue, 16 Jun 2026 00:00:00 GMTautomationautomationsecuritykubernetesrbacguardrailshttps://devopsaitoolkit.com/blog/build-an-ai-intent-router-for-teams-chatops/https://devopsaitoolkit.com/blog/build-an-ai-intent-router-for-teams-chatops/Stop writing brittle regex command parsers for your Teams bot. Use an LLM to classify what an engineer actually wants and route to the right runbook safely.Tue, 16 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamschatopsbot-frameworkaiintenthttps://devopsaitoolkit.com/blog/build-an-ai-on-call-assistant-card-for-teams/https://devopsaitoolkit.com/blog/build-an-ai-on-call-assistant-card-for-teams/A bot that answers on-call questions in-channel from your runbooks and recent alerts, rendered as an Adaptive Card. Here's the RAG-plus-card pattern done safely.Tue, 16 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsbot-frameworkragaiincident-responsehttps://devopsaitoolkit.com/blog/building-a-linux-log-triage-workflow-with-an-ai-copilot/https://devopsaitoolkit.com/blog/building-a-linux-log-triage-workflow-with-an-ai-copilot/Turn ad-hoc log spelunking into a repeatable triage workflow. Centralize logs, build a copilot loop, and let AI surface root cause from journald and rsyslog noise.Tue, 16 Jun 2026 00:00:00 GMTlinux-adminslinuxloggingobservabilityincident-responsesysadminhttps://devopsaitoolkit.com/blog/building-alert-runbook-annotations-with-ai/https://devopsaitoolkit.com/blog/building-alert-runbook-annotations-with-ai/Every alert should link a runbook, but most don't because writing them is tedious. How I use AI to draft alert annotations and runbooks useful at 3am.Tue, 16 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusalertingrunbooksaiincident-responsehttps://devopsaitoolkit.com/blog/building-an-ai-assisted-openstack-on-call-workflow/https://devopsaitoolkit.com/blog/building-an-ai-assisted-openstack-on-call-workflow/A field-tested on-call workflow for OpenStack that uses AI to triage alert storms and draft writeups, while keeping it firmly out of the production control plane.Tue, 16 Jun 2026 00:00:00 GMTopenstackopenstackon-callincident-responsesrehttps://devopsaitoolkit.com/blog/building-an-ai-ops-copilot-with-guardrails/https://devopsaitoolkit.com/blog/building-an-ai-ops-copilot-with-guardrails/How to build an internal ops assistant that reads telemetry and proposes actions but executes only through a constrained, audited, human-approved tool layer.Tue, 16 Jun 2026 00:00:00 GMTautomationautomationaisreguardrailstoolinghttps://devopsaitoolkit.com/blog/catching-risky-shell-commands-before-they-run-with-ai/https://devopsaitoolkit.com/blog/catching-risky-shell-commands-before-they-run-with-ai/Most production disasters start with a single mistyped command. Here's how I use AI as a pre-flight reviewer to flag destructive, irreversible, or scope-creeping shell commands before I hit enter.Tue, 16 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningshellailinuxhttps://devopsaitoolkit.com/blog/chatops-approval-gates-for-ai-suggested-actions/https://devopsaitoolkit.com/blog/chatops-approval-gates-for-ai-suggested-actions/AI proposes a fix in Slack; a human clicks Approve before anything runs. Build approval gates, authorization, time-boxing, audit logs, and scoped execution.Tue, 16 Jun 2026 00:00:00 GMTautomationautomationchatopsslackaiapprovalshttps://devopsaitoolkit.com/blog/converting-shell-scripts-to-ansible-with-ai/https://devopsaitoolkit.com/blog/converting-shell-scripts-to-ansible-with-ai/Every team has a pile of bash that should be Ansible. Here's how I use AI to convert shell scripts into idempotent playbooks, and where it gets it wrong.Tue, 16 Jun 2026 00:00:00 GMTansibleiacansibleaibashmigrationhttps://devopsaitoolkit.com/blog/debugging-a-flaky-automation-script-with-ai-step-by-step/https://devopsaitoolkit.com/blog/debugging-a-flaky-automation-script-with-ai-step-by-step/A flaky bash or Python script that fails one run in ten is the worst kind. Use AI to form hypotheses, add instrumentation, and pin down race conditions and timeouts.Tue, 16 Jun 2026 00:00:00 GMTbash-python-automationbashpythondebuggingreliabilityhttps://devopsaitoolkit.com/blog/debugging-ansible-failures-faster-with-ai/https://devopsaitoolkit.com/blog/debugging-ansible-failures-faster-with-ai/Ansible errors can be cryptic. Here's how I feed failed runs to AI to decode the real cause fast, with verbose output and check-mode to confirm the fix.Tue, 16 Jun 2026 00:00:00 GMTansibleiacansibleaidebuggingtroubleshootinghttps://devopsaitoolkit.com/blog/debugging-cryptic-terraform-errors-with-ai/https://devopsaitoolkit.com/blog/debugging-cryptic-terraform-errors-with-ai/Terraform error messages range from clear to baffling. AI is a fast translator for the baffling ones, if you give it the config and the full error, not a screenshot.Tue, 16 Jun 2026 00:00:00 GMTterraformterraformaidebuggingerrorshttps://devopsaitoolkit.com/blog/debugging-kubernetes-service-connectivity-with-ai/https://devopsaitoolkit.com/blog/debugging-kubernetes-service-connectivity-with-ai/Connection refused inside a cluster has a dozen causes. Here's how I use AI to walk the path from Service to endpoints to pod and find the break fast.Tue, 16 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesnetworkingserviceaitroubleshootinghttps://devopsaitoolkit.com/blog/debugging-linux-processes-with-strace-and-ltrace/https://devopsaitoolkit.com/blog/debugging-linux-processes-with-strace-and-ltrace/Use strace and ltrace to see exactly what a misbehaving Linux process is doing at the syscall level, and let AI translate dense traces into a clear root cause.Tue, 16 Jun 2026 00:00:00 GMTlinux-adminslinuxstracedebuggingtroubleshootingsysadminhttps://devopsaitoolkit.com/blog/debugging-nova-scheduler-novalidhost-with-ai/https://devopsaitoolkit.com/blog/debugging-nova-scheduler-novalidhost-with-ai/A seasoned operator's guide to chasing down Nova NoValidHost errors with AI as a co-pilot: scheduler logs, filters, placement candidates, and flavor extra_specs.Tue, 16 Jun 2026 00:00:00 GMTopenstackopenstacknovaschedulertroubleshootinghttps://devopsaitoolkit.com/blog/debugging-prometheus-no-data-alerts-with-ai/https://devopsaitoolkit.com/blog/debugging-prometheus-no-data-alerts-with-ai/An alert that never fires feels safe and is the most dangerous kind. How I use AI to diagnose no-data alerts, stale series, and rules that quietly broke.Tue, 16 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusalertingpromqlaitroubleshootinghttps://devopsaitoolkit.com/blog/design-adaptive-card-incident-alerts-with-ai/https://devopsaitoolkit.com/blog/design-adaptive-card-incident-alerts-with-ai/Hand an LLM your alert payload and a layout spec, and let it draft the Adaptive Card JSON. Here's how I prompt for cards that pass schema validation and render cleanly.Tue, 16 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsadaptive-cardsalertingaijsonhttps://devopsaitoolkit.com/blog/designing-terraform-modules-with-ai-as-a-junior-engineer/https://devopsaitoolkit.com/blog/designing-terraform-modules-with-ai-as-a-junior-engineer/AI can scaffold a Terraform module in seconds, but a good module is about interface design, not typing speed. Here is how to use AI without inheriting its bad defaults.Tue, 16 Jun 2026 00:00:00 GMTterraformterraformaimodulesdesignhttps://devopsaitoolkit.com/blog/diagnosing-rabbitmq-queue-buildup-openstack-ai/https://devopsaitoolkit.com/blog/diagnosing-rabbitmq-queue-buildup-openstack-ai/How I use AI to triage RabbitMQ queue buildup, network partitions, stale reply queues, and oslo.messaging heartbeat timeouts in OpenStack control planes.Tue, 16 Jun 2026 00:00:00 GMTopenstackopenstackrabbitmqmessagingtroubleshootinghttps://devopsaitoolkit.com/blog/diffing-helm-values-for-upgrades-with-ai/https://devopsaitoolkit.com/blog/diffing-helm-values-for-upgrades-with-ai/Helm upgrades break when a values default changes underneath you. Here's how I use AI to diff old and new values, spot risky changes, and upgrade safely.Tue, 16 Jun 2026 00:00:00 GMTkubernetes-helmkuberneteshelmupgradeaivalueshttps://devopsaitoolkit.com/blog/dockerfile-security-review-with-ai/https://devopsaitoolkit.com/blog/dockerfile-security-review-with-ai/Most container risk is baked in at build time. Here's how I use AI to review Dockerfiles for root users, leaked secrets, fat images, and unpinned bases before they ever ship.Tue, 16 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningdockercontainersaihttps://devopsaitoolkit.com/blog/drafting-customer-incident-updates-with-ai-honest-and-fast/https://devopsaitoolkit.com/blog/drafting-customer-incident-updates-with-ai-honest-and-fast/Customers forgive outages but not silence. Here's how to use AI to draft clear, honest status updates fast, without letting a model overpromise or leak details.Tue, 16 Jun 2026 00:00:00 GMTincident-responseincident-responseaicommunicationstatus-pageon-callhttps://devopsaitoolkit.com/blog/drafting-runbooks-from-resolved-incidents-with-ai/https://devopsaitoolkit.com/blog/drafting-runbooks-from-resolved-incidents-with-ai/The best time to write a runbook is right after you've fixed the thing. Here's how to use AI to turn a fresh resolution into a runbook on-call can trust.Tue, 16 Jun 2026 00:00:00 GMTincident-responseincident-responseairunbookson-callsrehttps://devopsaitoolkit.com/blog/dry-run-and-simulation-before-automated-actions/https://devopsaitoolkit.com/blog/dry-run-and-simulation-before-automated-actions/Make every automated action prove itself first with dry-run modes, plan diffing, staging replicas, and AI diff summaries that flag risky changes for a human.Tue, 16 Jun 2026 00:00:00 GMTautomationautomationdry-runterraformkubernetesaihttps://devopsaitoolkit.com/blog/finding-public-cloud-exposure-with-ai-s3-and-iam/https://devopsaitoolkit.com/blog/finding-public-cloud-exposure-with-ai-s3-and-iam/Public buckets and over-broad IAM are the top cloud breach causes. Here's how I use AI to audit S3 policies and IAM grants for accidental public access and wildcard permissions.Tue, 16 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningawsiamaihttps://devopsaitoolkit.com/blog/finding-similar-past-incidents-with-ai-stop-rediscovering-the-fix/https://devopsaitoolkit.com/blog/finding-similar-past-incidents-with-ai-stop-rediscovering-the-fix/Half the incidents you fight at 3am, someone already solved last quarter. Here's how to use AI to surface similar past incidents and stop re-debugging them.Tue, 16 Jun 2026 00:00:00 GMTincident-responseincident-responseaipostmortemknowledge-basesrehttps://devopsaitoolkit.com/blog/from-dockerfile-to-first-kubernetes-deployment-with-ai/https://devopsaitoolkit.com/blog/from-dockerfile-to-first-kubernetes-deployment-with-ai/Shipping an app to Kubernetes the first time means a pile of YAML. Here's how I use AI to scaffold a sane Deployment, Service, and config split safely.Tue, 16 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesdeploymentyamlaibeginnerhttps://devopsaitoolkit.com/blog/generate-power-automate-flows-for-teams-with-ai/https://devopsaitoolkit.com/blog/generate-power-automate-flows-for-teams-with-ai/Describe the flow you want, let an LLM draft the trigger, conditions, and Teams actions, then import and test. A practical guide to AI-assisted Power Automate for DevOps.Tue, 16 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamspower-automateworkflowsaiautomationhttps://devopsaitoolkit.com/blog/generating-ansible-jinja2-templates-with-ai-safely/https://devopsaitoolkit.com/blog/generating-ansible-jinja2-templates-with-ai-safely/Jinja2 templates are where Ansible gets powerful and dangerous. Here's how I use AI to generate templates without shipping broken config to prod.Tue, 16 Jun 2026 00:00:00 GMTansibleiacansibleaijinja2templateshttps://devopsaitoolkit.com/blog/hardening-a-bash-script-with-ai-strict-mode-traps-back-out/https://devopsaitoolkit.com/blog/hardening-a-bash-script-with-ai-strict-mode-traps-back-out/Use AI to turn a fragile bash script into a production-grade one — strict mode, error traps, cleanup handlers, and a back-out path you can trust under load.Tue, 16 Jun 2026 00:00:00 GMTbash-python-automationbashpythonerror-handlingproductionhttps://devopsaitoolkit.com/blog/hardening-a-pod-securitycontext-with-ai-review/https://devopsaitoolkit.com/blog/hardening-a-pod-securitycontext-with-ai-review/Most pods run with more privilege than they need. Here's how I use AI to harden securityContext fields without breaking the workload — verified, not blind.Tue, 16 Jun 2026 00:00:00 GMTkubernetes-helmkubernetessecuritysecuritycontextaihardeninghttps://devopsaitoolkit.com/blog/humanizing-artificial-intelligence-in-log-analysis/https://devopsaitoolkit.com/blog/humanizing-artificial-intelligence-in-log-analysis/How AI turns raw Linux, Kubernetes, OpenStack, and application logs into clear, plain-English DevOps troubleshooting steps — with a human still in control.Tue, 16 Jun 2026 00:00:00 GMTincident-responselog-analysisaiincident-responsekubernetesobservabilityhttps://devopsaitoolkit.com/blog/humanizing-artificial-intelligence-in-metrics-analysis/https://devopsaitoolkit.com/blog/humanizing-artificial-intelligence-in-metrics-analysis/How AI turns raw Prometheus metrics, PromQL, and Grafana dashboards into clear, plain-English answers about what changed and why — with a human still in control.Tue, 16 Jun 2026 00:00:00 GMTprometheus-monitoringmetricsaiprometheuspromqlobservabilityhttps://devopsaitoolkit.com/blog/investigating-prometheus-cardinality-spikes-with-ai/https://devopsaitoolkit.com/blog/investigating-prometheus-cardinality-spikes-with-ai/A cardinality explosion can OOM Prometheus overnight. How I use AI to find the offending label, trace its source, and design a relabel fix without guessing.Tue, 16 Jun 2026 00:00:00 GMTprometheus-monitoringprometheuscardinalitypromqlaitroubleshootinghttps://devopsaitoolkit.com/blog/knowing-when-to-roll-back-your-automation/https://devopsaitoolkit.com/blog/knowing-when-to-roll-back-your-automation/Automation misbehaves. Here's how to set SLOs for your automation itself, build kill switches and circuit breakers, and use AI to flag what to roll back.Tue, 16 Jun 2026 00:00:00 GMTautomationautomationreliabilitysrerollbackcircuit-breakerhttps://devopsaitoolkit.com/blog/kubernetes-operator-pattern-a-devops-engineers-guide/https://devopsaitoolkit.com/blog/kubernetes-operator-pattern-a-devops-engineers-guide/What the Kubernetes Operator pattern is and how CRDs, controllers, and reconciliation loops automate stateful Day 2 operations like failover and backups in production.Tue, 16 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesoperatorscrdcontrollersautomationhttps://devopsaitoolkit.com/blog/linux-backup-and-restore-with-rsync-and-borg/https://devopsaitoolkit.com/blog/linux-backup-and-restore-with-rsync-and-borg/Build reliable Linux backups with rsync and BorgBackup: deduplication, encryption, retention, and tested restores. Use AI to draft and review your backup scripts.Tue, 16 Jun 2026 00:00:00 GMTlinux-adminslinuxbackupborgrsyncsysadminhttps://devopsaitoolkit.com/blog/linux-package-management-patching-apt-dnf-with-ai/https://devopsaitoolkit.com/blog/linux-package-management-patching-apt-dnf-with-ai/Plan and apply package updates on Ubuntu, Debian, and RHEL safely. Use AI to read changelogs, triage held packages, and draft a rollback plan before you patch.Tue, 16 Jun 2026 00:00:00 GMTlinux-adminslinuxaptdnfpatchingsysadminhttps://devopsaitoolkit.com/blog/managing-tls-certificates-with-certbot-and-letsencrypt/https://devopsaitoolkit.com/blog/managing-tls-certificates-with-certbot-and-letsencrypt/Issue, renew, and debug Let's Encrypt certificates with Certbot on Linux. Handle DNS challenges, automate renewals, and use AI to decode openssl and ACME errors.Tue, 16 Jun 2026 00:00:00 GMTlinux-adminslinuxtlscertbotsecuritysysadminhttps://devopsaitoolkit.com/blog/natural-language-chatops-parsing-slash-commands-with-ai/https://devopsaitoolkit.com/blog/natural-language-chatops-parsing-slash-commands-with-ai/Turn plain-English Slack requests into safe, allow-listed actions using an LLM to parse intent, a confirmation modal, and human-reviewed guardrails before anything runs.Tue, 16 Jun 2026 00:00:00 GMTslackslackchatopsboltautomationhttps://devopsaitoolkit.com/blog/onboarding-to-a-huge-terraform-codebase-with-ai/https://devopsaitoolkit.com/blog/onboarding-to-a-huge-terraform-codebase-with-ai/Inheriting 200 modules and a sprawling state is intimidating. AI is a fast guide through unfamiliar Terraform, as long as you verify its map against the real plan.Tue, 16 Jun 2026 00:00:00 GMTterraformterraformaionboardingmoduleshttps://devopsaitoolkit.com/blog/optimizing-gitlab-pipeline-dags-with-needs-using-ai/https://devopsaitoolkit.com/blog/optimizing-gitlab-pipeline-dags-with-needs-using-ai/Stage-by-stage pipelines waste time waiting. Here's how I use AI to convert a slow GitLab pipeline into a needs-based DAG that runs jobs as early as possible.Tue, 16 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdaidagperformancehttps://devopsaitoolkit.com/blog/rag-runbook-bot-answering-ops-questions-in-slack/https://devopsaitoolkit.com/blog/rag-runbook-bot-answering-ops-questions-in-slack/Ground an LLM in your internal runbooks so a Slack bot answers ops questions with real sources, not hallucinations — retrieval, prompting, Block Kit, and the safety rails that matter.Tue, 16 Jun 2026 00:00:00 GMTslackslackchatopsragaihttps://devopsaitoolkit.com/blog/reading-openstack-placement-inventories-with-ai/https://devopsaitoolkit.com/blog/reading-openstack-placement-inventories-with-ai/How to use AI to read and cross-tabulate OpenStack Placement resource provider inventories, spot capacity exhaustion, and verify before you ever act on it.Tue, 16 Jun 2026 00:00:00 GMTopenstackopenstackplacementnovacapacity-planninghttps://devopsaitoolkit.com/blog/reconstructing-an-incident-timeline-from-chat-logs-with-ai/https://devopsaitoolkit.com/blog/reconstructing-an-incident-timeline-from-chat-logs-with-ai/The timeline is the spine of every postmortem and the part everyone dreads. Here's how to use AI to rebuild it from messy chat logs without inventing facts.Tue, 16 Jun 2026 00:00:00 GMTpostmortemsincident-responseaipostmortemtimelinesrehttps://devopsaitoolkit.com/blog/recovering-corrupted-linux-filesystems-with-fsck/https://devopsaitoolkit.com/blog/recovering-corrupted-linux-filesystems-with-fsck/A calm, step-by-step guide to running fsck on ext4 and XFS, reading the errors, and using AI to interpret filesystem damage before you risk making it worse.Tue, 16 Jun 2026 00:00:00 GMTlinux-adminslinuxfilesystemfsckrecoverytroubleshootinghttps://devopsaitoolkit.com/blog/recovering-stuck-cinder-volumes-with-ai/https://devopsaitoolkit.com/blog/recovering-stuck-cinder-volumes-with-ai/How a veteran operator unwinds Cinder volumes wedged in creating, deleting, or attaching states using reset-state carefully, with AI assisting safely.Tue, 16 Jun 2026 00:00:00 GMTopenstackopenstackcinderstoragerecoveryhttps://devopsaitoolkit.com/blog/refactoring-a-monolithic-bash-script-into-functions-with-ai/https://devopsaitoolkit.com/blog/refactoring-a-monolithic-bash-script-into-functions-with-ai/Turn a 500-line wall of bash into clean, testable functions with AI help — extracting units, passing arguments safely, and keeping behavior identical throughout.Tue, 16 Jun 2026 00:00:00 GMTbash-python-automationbashpythonrefactoringfunctionshttps://devopsaitoolkit.com/blog/refactoring-legacy-alerts-to-burn-rate-with-ai/https://devopsaitoolkit.com/blog/refactoring-legacy-alerts-to-burn-rate-with-ai/Old 'error rate over 1% for 5m' alerts page too much and catch too little. How I use AI to migrate threshold alerts to SLO burn-rate alerting safely.Tue, 16 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusalertingsloburn-rateaimigrationhttps://devopsaitoolkit.com/blog/reviewing-a-helm-chart-with-ai-before-you-ship-it/https://devopsaitoolkit.com/blog/reviewing-a-helm-chart-with-ai-before-you-ship-it/A pre-ship Helm chart review catches templating bugs, missing limits, and bad defaults. Here's how I use an AI copilot to do it without trusting it blindly.Tue, 16 Jun 2026 00:00:00 GMTkubernetes-helmkuberneteshelmreviewaiyamlhttps://devopsaitoolkit.com/blog/reviewing-ai-generated-prometheus-alert-rules/https://devopsaitoolkit.com/blog/reviewing-ai-generated-prometheus-alert-rules/AI writes alert rules in seconds, but a bad rule pages you at 3am or hides an outage. The review checklist I run on every AI-generated Prometheus alert.Tue, 16 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusalertingaicode-reviewsrehttps://devopsaitoolkit.com/blog/reviewing-cloudformation-templates-for-drift-with-ai/https://devopsaitoolkit.com/blog/reviewing-cloudformation-templates-for-drift-with-ai/CloudFormation drift creeps in when someone clicks in the console. Here's how I use AI to read drift reports, explain them, and propose safe reconciliation.Tue, 16 Jun 2026 00:00:00 GMTiaciacansibleaicloudformationdrifthttps://devopsaitoolkit.com/blog/reviewing-linux-kernel-sysctl-hardening-with-ai/https://devopsaitoolkit.com/blog/reviewing-linux-kernel-sysctl-hardening-with-ai/Kernel tunables control your network stack, memory, and attack surface. Here's how I use AI to review sysctl hardening settings against CIS guidance without breaking production networking.Tue, 16 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeninglinuxkernelaihttps://devopsaitoolkit.com/blog/reviewing-nginx-security-configuration-with-ai/https://devopsaitoolkit.com/blog/reviewing-nginx-security-configuration-with-ai/Your reverse proxy is your front door. Here's how I use AI to audit nginx configs for weak TLS, leaked version headers, missing security headers, and path-traversal footguns.Tue, 16 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningnginxtlsaihttps://devopsaitoolkit.com/blog/reviewing-terraform-iam-changes-with-ai-before-they-ship/https://devopsaitoolkit.com/blog/reviewing-terraform-iam-changes-with-ai-before-they-ship/IAM policy diffs are where Terraform plans quietly grant too much. AI is a sharp reviewer for privilege creep, if you feed it the right structured input.Tue, 16 Jun 2026 00:00:00 GMTterraformterraformaiiamsecurityreviewhttps://devopsaitoolkit.com/blog/scaffolding-a-bolt-app-with-ai-fast-junior-workflow/https://devopsaitoolkit.com/blog/scaffolding-a-bolt-app-with-ai-fast-junior-workflow/Use AI to scaffold a Slack Bolt app fast — boilerplate, event handlers, manifest — with a disciplined review checklist before it touches a real workspace.Tue, 16 Jun 2026 00:00:00 GMTslackslackchatopsboltaihttps://devopsaitoolkit.com/blog/the-ai-incident-scribe-real-time-notes-without-pulling-a-responder/https://devopsaitoolkit.com/blog/the-ai-incident-scribe-real-time-notes-without-pulling-a-responder/Every incident needs a scribe, but assigning one means losing a responder. Here's how AI can keep a live incident record while your people stay on the fix.Tue, 16 Jun 2026 00:00:00 GMTincident-responseincident-responseaiscribeon-calldocumentationhttps://devopsaitoolkit.com/blog/the-role-of-service-mesh-in-devops-2026-guide/https://devopsaitoolkit.com/blog/the-role-of-service-mesh-in-devops-2026-guide/How a service mesh optimizes microservice communication, enforces mTLS security, and delivers full observability — plus the real operational trade-offs in 2026.Tue, 16 Jun 2026 00:00:00 GMTkubernetes-helmservice-meshkubernetesistioobservabilitymicroserviceshttps://devopsaitoolkit.com/blog/translate-webhook-payloads-to-adaptive-cards-with-ai/https://devopsaitoolkit.com/blog/translate-webhook-payloads-to-adaptive-cards-with-ai/Every tool sends a different JSON shape. Use an LLM to generate the mapping from arbitrary webhook payloads to clean Teams Adaptive Cards, then bake it into code.Tue, 16 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsadaptive-cardswebhooksaiintegrationhttps://devopsaitoolkit.com/blog/translating-a-bash-script-to-python-with-ai-without-breaking-it/https://devopsaitoolkit.com/blog/translating-a-bash-script-to-python-with-ai-without-breaking-it/When a bash script outgrows itself, AI can port it to Python fast — but quoting, exit codes, and subprocess pitfalls hide subtle bugs. Here's how to translate safely.Tue, 16 Jun 2026 00:00:00 GMTbash-python-automationbashpythonsubprocessmigrationhttps://devopsaitoolkit.com/blog/translating-slo-requirements-into-promql-with-ai/https://devopsaitoolkit.com/blog/translating-slo-requirements-into-promql-with-ai/Your SLO lives in a doc as English prose. How I use AI to translate '99.9% of checkouts succeed' into correct SLI queries, budgets, and burn-rate alerts.Tue, 16 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusslopromqlaierror-budgetsrehttps://devopsaitoolkit.com/blog/triaging-disk-space-exhaustion-on-linux/https://devopsaitoolkit.com/blog/triaging-disk-space-exhaustion-on-linux/When a Linux server runs out of disk, find the culprit fast. Hunt down space and inode exhaustion with df, du, and ncdu, and use AI to triage the output safely.Tue, 16 Jun 2026 00:00:00 GMTlinux-adminslinuxdisktroubleshootingmonitoringsysadminhttps://devopsaitoolkit.com/blog/triaging-kubernetes-pod-logs-at-scale-with-ai/https://devopsaitoolkit.com/blog/triaging-kubernetes-pod-logs-at-scale-with-ai/When a service degrades, the answer hides across dozens of pod log streams. Here's how I use AI to find the signal fast without shipping logs anywhere risky.Tue, 16 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesloggingobservabilityaitroubleshootinghttps://devopsaitoolkit.com/blog/triaging-terraform-drift-alerts-with-ai-without-blind-reapplies/https://devopsaitoolkit.com/blog/triaging-terraform-drift-alerts-with-ai-without-blind-reapplies/Drift detection fires alerts; deciding which ones matter is the hard part. AI triages drift between benign and dangerous, but a human still approves every reconcile.Tue, 16 Jun 2026 00:00:00 GMTterraformterraformaidrifttriagehttps://devopsaitoolkit.com/blog/tuning-pod-resource-requests-from-metrics-with-ai/https://devopsaitoolkit.com/blog/tuning-pod-resource-requests-from-metrics-with-ai/Guessing CPU and memory requests wastes money or causes evictions. Here's how I use AI to turn real usage metrics into sane requests and limits — with checks.Tue, 16 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesresourcesmetricsaioptimizationhttps://devopsaitoolkit.com/blog/turn-teams-meeting-transcripts-into-postmortems-with-ai/https://devopsaitoolkit.com/blog/turn-teams-meeting-transcripts-into-postmortems-with-ai/Pull the meeting transcript from Microsoft Graph after an incident bridge, feed it to an LLM with a tight prompt, and get a blameless postmortem draft in minutes.Tue, 16 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsgraph-apipostmortemincident-responseaihttps://devopsaitoolkit.com/blog/turning-a-postmortem-into-action-items-with-ai/https://devopsaitoolkit.com/blog/turning-a-postmortem-into-action-items-with-ai/Most postmortems generate action items that quietly die. Here's how to use AI to extract sharp, ownable, trackable follow-ups that actually get done.Tue, 16 Jun 2026 00:00:00 GMTpostmortemsincident-responseaipostmortemaction-itemssrehttps://devopsaitoolkit.com/blog/turning-tribal-knowledge-into-automation-with-ai/https://devopsaitoolkit.com/blog/turning-tribal-knowledge-into-automation-with-ai/The senior engineer who just knows how to fix the flaky job. Use AI to extract that tacit knowledge into structured runbooks and safe, idempotent automation.Tue, 16 Jun 2026 00:00:00 GMTautomationautomationrunbooksaiknowledgeansiblehttps://devopsaitoolkit.com/blog/untangling-inherited-promql-queries-with-ai/https://devopsaitoolkit.com/blog/untangling-inherited-promql-queries-with-ai/Inherited a 200-character PromQL one-liner with no comments? How I use AI to decompose, explain, and safely refactor gnarly queries without breaking dashboards.Tue, 16 Jun 2026 00:00:00 GMTprometheus-monitoringprometheuspromqlairefactoringobservabilityhttps://devopsaitoolkit.com/blog/using-ai-to-add-tests-to-a-crufty-python-automation-script/https://devopsaitoolkit.com/blog/using-ai-to-add-tests-to-a-crufty-python-automation-script/A practical workflow for wrapping an untested, legacy Python automation script in pytest using AI — characterization tests, dependency seams, and safe refactors.Tue, 16 Jun 2026 00:00:00 GMTbash-python-automationpythonbashpytesttestingrefactoringhttps://devopsaitoolkit.com/blog/using-ai-to-document-undocumented-ansible-codebases/https://devopsaitoolkit.com/blog/using-ai-to-document-undocumented-ansible-codebases/You inherited a 300-role Ansible repo with no docs. Here's how I use AI to map it, generate role READMEs, and document variables without trusting it blindly.Tue, 16 Jun 2026 00:00:00 GMTansibleiacansibleaidocumentationonboardinghttps://devopsaitoolkit.com/blog/using-ai-to-explain-and-document-inherited-gitlab-pipelines/https://devopsaitoolkit.com/blog/using-ai-to-explain-and-document-inherited-gitlab-pipelines/Inheriting an undocumented .gitlab-ci.yml is daunting. Here's how I use AI to reverse-engineer a complex pipeline into a clear diagram and trustworthy docs.Tue, 16 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdaidocumentationonboardinghttps://devopsaitoolkit.com/blog/using-ai-to-generate-and-review-helm-charts/https://devopsaitoolkit.com/blog/using-ai-to-generate-and-review-helm-charts/Helm templating is fiddly and easy to get subtly wrong. Here's how I use AI to scaffold charts and review values, with helm template and lint as the safety net.Tue, 16 Jun 2026 00:00:00 GMTiaciacansibleaihelmkuberneteshttps://devopsaitoolkit.com/blog/using-ai-to-generate-incident-hypotheses-without-anchoring-the-team/https://devopsaitoolkit.com/blog/using-ai-to-generate-incident-hypotheses-without-anchoring-the-team/A murky incident is where teams tunnel on the wrong cause. Here's how to use AI to broaden your hypothesis list without letting its first guess anchor everyone.Tue, 16 Jun 2026 00:00:00 GMTincident-responseincident-responseaitroubleshootingsreon-callhttps://devopsaitoolkit.com/blog/using-ai-to-harden-gitlab-ci-security-scanning/https://devopsaitoolkit.com/blog/using-ai-to-harden-gitlab-ci-security-scanning/GitLab ships SAST, dependency, and container scanning, but the defaults leave gaps. Here's how I use AI to tune scanning jobs and triage findings safely.Tue, 16 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdaisecuritysasthttps://devopsaitoolkit.com/blog/using-ai-to-make-an-ansible-playbook-truly-idempotent/https://devopsaitoolkit.com/blog/using-ai-to-make-an-ansible-playbook-truly-idempotent/Idempotency is where most Ansible playbooks quietly fail. Here's how I use AI to hunt down the non-idempotent tasks, with check-mode discipline to prove it.Tue, 16 Jun 2026 00:00:00 GMTansibleiacansibleaiidempotencycheck-modehttps://devopsaitoolkit.com/blog/using-ai-to-migrate-jenkins-pipelines-to-gitlab-ci/https://devopsaitoolkit.com/blog/using-ai-to-migrate-jenkins-pipelines-to-gitlab-ci/Translating a Jenkinsfile to .gitlab-ci.yml by hand is slow and tedious. Here's how I use AI to do the bulk conversion and where it predictably gets it wrong.Tue, 16 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdaijenkinsmigrationhttps://devopsaitoolkit.com/blog/using-ai-to-plan-a-safe-terraform-state-migration/https://devopsaitoolkit.com/blog/using-ai-to-plan-a-safe-terraform-state-migration/State surgery is the scariest part of Terraform. AI can map out a state migration plan step by step, but it must never run a single state command itself.Tue, 16 Jun 2026 00:00:00 GMTterraformterraformaistatemigrationhttps://devopsaitoolkit.com/blog/using-ai-to-review-a-cron-job-before-it-runs-in-prod/https://devopsaitoolkit.com/blog/using-ai-to-review-a-cron-job-before-it-runs-in-prod/Cron jobs fail silently at 3am. Use AI to review scheduling, locking, logging, and error handling in your bash and Python cron scripts before they cause an incident.Tue, 16 Jun 2026 00:00:00 GMTbash-python-automationbashpythoncronschedulinghttps://devopsaitoolkit.com/blog/using-ai-to-survive-a-terraform-provider-major-version-bump/https://devopsaitoolkit.com/blog/using-ai-to-survive-a-terraform-provider-major-version-bump/A major provider upgrade can rewrite half your plan. AI reads the changelog and your code together to find the breaking changes before they break you.Tue, 16 Jun 2026 00:00:00 GMTterraformterraformaiprovidersupgradehttps://devopsaitoolkit.com/blog/using-ai-to-write-ansible-molecule-tests-for-your-roles/https://devopsaitoolkit.com/blog/using-ai-to-write-ansible-molecule-tests-for-your-roles/Most Ansible roles ship untested. Here's how I use AI to scaffold Molecule scenarios and write Testinfra assertions that actually catch regressions.Tue, 16 Jun 2026 00:00:00 GMTansibleiacansibleaimoleculetestinghttps://devopsaitoolkit.com/blog/using-ai-to-write-gitlab-ci-tests-and-coverage-jobs/https://devopsaitoolkit.com/blog/using-ai-to-write-gitlab-ci-tests-and-coverage-jobs/Test jobs, JUnit reports, and coverage gating in GitLab CI are fiddly to wire up. Here's how I use AI to scaffold them and surface results in merge requests.Tue, 16 Jun 2026 00:00:00 GMTgitlab-cicdgitlabci-cdaitestingcoveragehttps://devopsaitoolkit.com/blog/verifying-slack-webhook-signatures-with-ai-help/https://devopsaitoolkit.com/blog/verifying-slack-webhook-signatures-with-ai-help/Correctly verify Slack request signatures using the v0 HMAC SHA256 scheme, constant-time compare, and replay window, with AI as a fast junior you review.Tue, 16 Jun 2026 00:00:00 GMTslackslackchatopssecuritywebhookshttps://devopsaitoolkit.com/blog/write-microsoft-graph-automation-scripts-with-ai/https://devopsaitoolkit.com/blog/write-microsoft-graph-automation-scripts-with-ai/Graph's API surface is huge and the docs are a maze. Use an LLM to draft Teams automation scripts against Graph, then verify permissions and test in a sandbox tenant.Tue, 16 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsgraph-apiautomationaipowershellhttps://devopsaitoolkit.com/blog/writing-an-internal-incident-review-with-ai-for-engineers-not-execs/https://devopsaitoolkit.com/blog/writing-an-internal-incident-review-with-ai-for-engineers-not-execs/Exec updates and engineer reviews need opposite things. Here's how to use AI to draft the deep technical incident review engineers learn from.Tue, 16 Jun 2026 00:00:00 GMTpostmortemsincident-responseaipostmortemengineeringsrehttps://devopsaitoolkit.com/blog/writing-kubernetes-admission-policies-with-an-ai-copilot/https://devopsaitoolkit.com/blog/writing-kubernetes-admission-policies-with-an-ai-copilot/Admission policies are powerful and easy to get wrong. Here's how I draft Kyverno and CEL rules with AI, then test them in Audit mode before enforcing.Tue, 16 Jun 2026 00:00:00 GMTkubernetes-helmkubernetespolicykyvernosecurityaihttps://devopsaitoolkit.com/blog/writing-openstack-diagnostic-runbooks-with-ai/https://devopsaitoolkit.com/blog/writing-openstack-diagnostic-runbooks-with-ai/A practical guide to prompting an LLM to draft OpenStack triage runbooks: structure, CLI check sequences, log redaction, version control, and human review.Tue, 16 Jun 2026 00:00:00 GMTopenstackopenstackrunbooksprompt-engineeringsrehttps://devopsaitoolkit.com/blog/writing-terraform-policy-as-code-rules-with-ai/https://devopsaitoolkit.com/blog/writing-terraform-policy-as-code-rules-with-ai/Rego and Sentinel are easy to get subtly wrong. AI can draft policy-as-code for Terraform fast, but every rule needs a failing test before you trust it as a gate.Tue, 16 Jun 2026 00:00:00 GMTterraformterraformaipolicy-as-codeopasentinelhttps://devopsaitoolkit.com/blog/writing-terraform-tests-with-ai-without-faking-the-coverage/https://devopsaitoolkit.com/blog/writing-terraform-tests-with-ai-without-faking-the-coverage/AI can churn out Terraform native test files fast, but most of what it writes tests nothing. Here is how to get assertions that would actually catch a regression.Tue, 16 Jun 2026 00:00:00 GMTterraformterraformaitestingtflinthttps://devopsaitoolkit.com/blog/best-ai-tools-for-incident-response/https://devopsaitoolkit.com/blog/best-ai-tools-for-incident-response/A practical, vendor-honest roundup of the best AI tools for incident response in 2026 — triage, log analysis, RCA, postmortems, runbooks, and ChatOps with a human always in the loop.Mon, 15 Jun 2026 00:00:00 GMTincident-responseai-toolsincident-responsesreon-callrounduphttps://devopsaitoolkit.com/blog/best-ai-tools-for-linux-admins/https://devopsaitoolkit.com/blog/best-ai-tools-for-linux-admins/A hands-on, honest roundup of the AI tools a Linux sysadmin actually benefits from in 2026 — assistants, AI editors, terminals, log analysis, and hardening.Mon, 15 Jun 2026 00:00:00 GMTlinux-adminsai-toolslinuxsysadminroundupproductivityhttps://devopsaitoolkit.com/blog/best-ai-tools-for-sre-teams/https://devopsaitoolkit.com/blog/best-ai-tools-for-sre-teams/A practical roundup of the AI tools that actually help SRE teams in 2026 — for incident response, PromQL, postmortems, toil reduction, and IaC review.Mon, 15 Jun 2026 00:00:00 GMTprometheus-monitoringai-toolssreobservabilityreliabilityrounduphttps://devopsaitoolkit.com/blog/chatgpt-vs-claude-for-devops/https://devopsaitoolkit.com/blog/chatgpt-vs-claude-for-devops/A hands-on ChatGPT vs Claude for DevOps comparison: Terraform, Kubernetes debugging, big config reasoning, guardrails, cost, and when to use which one.Mon, 15 Jun 2026 00:00:00 GMTautomationai-toolschatgptclaudedevopscomparisonhttps://devopsaitoolkit.com/blog/claude-vs-cursor-for-infrastructure-engineers/https://devopsaitoolkit.com/blog/claude-vs-cursor-for-infrastructure-engineers/Claude is a model; Cursor is an AI IDE that can run Claude. Here's how a Sr. Systems Engineer actually uses each for Terraform, Helm, and K8s work.Mon, 15 Jun 2026 00:00:00 GMTiacai-toolsclaudecursorinfrastructurecomparisonhttps://devopsaitoolkit.com/blog/adaptive-card-templating-bind-live-devops-data-to-one-card/https://devopsaitoolkit.com/blog/adaptive-card-templating-bind-live-devops-data-to-one-card/Stop string-concatenating JSON for every alert. Adaptive Card templates let you define a card once and bind live data with a templating language.Sun, 14 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsadaptive-cardstemplatingdevopsalertingjsonhttps://devopsaitoolkit.com/blog/advanced-cloud-init-recipes-for-production-server-bootstrapping/https://devopsaitoolkit.com/blog/advanced-cloud-init-recipes-for-production-server-bootstrapping/Past the hello-world user-data, cloud-init gets powerful: write_files, multi-part configs, jinja templating, boot stages, and debugging that doesn't waste hours.Sun, 14 Jun 2026 00:00:00 GMTiaciaccloud-initbootstrappinglinuxautomationcloudhttps://devopsaitoolkit.com/blog/ansible-execution-environments-and-collections-done-right/https://devopsaitoolkit.com/blog/ansible-execution-environments-and-collections-done-right/"Works on my machine" is a special kind of pain in Ansible. Execution environments and pinned collections make your automation reproducible everywhere.Sun, 14 Jun 2026 00:00:00 GMTansibleiacansibleexecution-environmentscollectionscontainersreproducibilityhttps://devopsaitoolkit.com/blog/argocd-sync-alerts-in-slack-for-gitops-teams/https://devopsaitoolkit.com/blog/argocd-sync-alerts-in-slack-for-gitops-teams/GitOps means your cluster drifts, syncs, and degrades on its own schedule. Here's how to wire ArgoCD notifications into Slack so you see it happen in real time.Sun, 14 Jun 2026 00:00:00 GMTslackslackargocdgitopskubernetesdevopsautomationhttps://devopsaitoolkit.com/blog/automated-rollback-strategies-for-safe-deploys/https://devopsaitoolkit.com/blog/automated-rollback-strategies-for-safe-deploys/How to build automated rollback that triggers on real signals — health gates, canary analysis, fast revert paths, and AI-assisted detection without false-positive thrash.Sun, 14 Jun 2026 00:00:00 GMTautomationautomationrollbackci-cddeploymentsrereliabilityhttps://devopsaitoolkit.com/blog/automating-github-with-python-and-the-rest-api/https://devopsaitoolkit.com/blog/automating-github-with-python-and-the-rest-api/From auto-labeling PRs to bulk repo audits, GitHub's API turns tedious org-wide chores into a script. Here's how to do it without getting rate-limited or leaking tokens.Sun, 14 Jun 2026 00:00:00 GMTbash-python-automationbashpythongithubapiautomationcihttps://devopsaitoolkit.com/blog/automating-openstack-with-the-python-sdk-and-cli/https://devopsaitoolkit.com/blog/automating-openstack-with-the-python-sdk-and-cli/Clicking through Horizon doesn't scale. Here's how I automate OpenStack with the openstacksdk, the unified CLI, and clouds.yaml for repeatable, idempotent operations.Sun, 14 Jun 2026 00:00:00 GMTopenstackopenstackautomationpython-sdkopenstackclientcloudsyamldevopshttps://devopsaitoolkit.com/blog/automating-tls-certificates-in-kubernetes-with-cert-manager/https://devopsaitoolkit.com/blog/automating-tls-certificates-in-kubernetes-with-cert-manager/Manually rotating TLS certs is how outages happen at 3am. Here's how to wire up cert-manager so certificates issue, renew, and recover themselves.Sun, 14 Jun 2026 00:00:00 GMTkubernetes-helmkubernetescert-managertlssecuritylets-encryptingresshttps://devopsaitoolkit.com/blog/autoscaling-clusters-with-openstack-senlin/https://devopsaitoolkit.com/blog/autoscaling-clusters-with-openstack-senlin/Senlin manages homogeneous clusters of nodes with policies for scaling, health, and load balancing. Here's how I use it for real autoscaling on OpenStack.Sun, 14 Jun 2026 00:00:00 GMTopenstackopenstacksenlinautoscalingclusteringheatdevopshttps://devopsaitoolkit.com/blog/autoscaling-gitlab-runners-with-fleeting-on-aws-spot/https://devopsaitoolkit.com/blog/autoscaling-gitlab-runners-with-fleeting-on-aws-spot/Docker Machine is gone. Fleeting is the new autoscaling model for GitLab Runner. Here's how I run cheap, elastic spot-backed runners without the old footguns.Sun, 14 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdrunnersawsautoscalingcost-optimizationhttps://devopsaitoolkit.com/blog/blocking-brute-force-attacks-with-fail2ban/https://devopsaitoolkit.com/blog/blocking-brute-force-attacks-with-fail2ban/fail2ban watches your logs and bans attackers automatically. Here's how to configure jails, filters, and bantime to lock down SSH and web services.Sun, 14 Jun 2026 00:00:00 GMTlinux-adminslinuxsecurityfail2bansshhardeningfirewallhttps://devopsaitoolkit.com/blog/build-llm-powered-teams-bots-with-the-teams-ai-library/https://devopsaitoolkit.com/blog/build-llm-powered-teams-bots-with-the-teams-ai-library/The Teams AI Library handles prompts, planning, and action routing so your bot can turn 'roll back payments' into a safe, confirmed operation. Here's the setup.Sun, 14 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsteams-ai-libraryllmchatopsdevopsaihttps://devopsaitoolkit.com/blog/building-a-scheduled-standup-bot-in-slack/https://devopsaitoolkit.com/blog/building-a-scheduled-standup-bot-in-slack/Async standup in Slack beats a 9am meeting — if the bot is built right. Here's how to schedule prompts, collect responses, and post a digest people actually read.Sun, 14 Jun 2026 00:00:00 GMTslackslackstandupasyncteamdevopsautomationhttps://devopsaitoolkit.com/blog/building-bash-tui-menus-with-dialog-and-whiptail/https://devopsaitoolkit.com/blog/building-bash-tui-menus-with-dialog-and-whiptail/Not every ops tool needs a web UI. A dialog-based menu turns a pile of bash scripts into something a tired teammate can run at 3am without memorizing flags.Sun, 14 Jun 2026 00:00:00 GMTbash-python-automationbashpythondialogwhiptailtuiautomationhttps://devopsaitoolkit.com/blog/building-continuous-terraform-drift-detection-into-your-pipeline/https://devopsaitoolkit.com/blog/building-continuous-terraform-drift-detection-into-your-pipeline/Catching drift once it's caused an outage is too late. Here's how to run scheduled drift detection that surfaces out-of-band changes before they bite you.Sun, 14 Jun 2026 00:00:00 GMTterraformterraformdrift-detectionciautomationmonitoringgitopshttps://devopsaitoolkit.com/blog/building-ops-bots-with-the-slack-bolt-framework/https://devopsaitoolkit.com/blog/building-ops-bots-with-the-slack-bolt-framework/Bolt strips away the HTTP plumbing so you can ship a working Slack ops bot in an afternoon. Here's how I structure a Bolt app that survives production.Sun, 14 Jun 2026 00:00:00 GMTslackslackboltchatopsnodejsdevopsautomationhttps://devopsaitoolkit.com/blog/building-self-healing-infrastructure-with-ai/https://devopsaitoolkit.com/blog/building-self-healing-infrastructure-with-ai/How to build self-healing infrastructure that detects, diagnoses, and recovers from common failures automatically — with AI in the loop and humans on the guardrails.Sun, 14 Jun 2026 00:00:00 GMTautomationautomationself-healingsrekubernetesaireliabilityhttps://devopsaitoolkit.com/blog/capacity-planning-with-prometheus-queries-that-predict/https://devopsaitoolkit.com/blog/capacity-planning-with-prometheus-queries-that-predict/Most teams find out they're out of capacity when it's already a 3am page. These PromQL patterns turn your existing metrics into forecasts of when you'll run out of headroom.Sun, 14 Jun 2026 00:00:00 GMTprometheus-monitoringprometheuscapacity-planningpromqlforecastingpredict-linearsrehttps://devopsaitoolkit.com/blog/catching-bad-infrastructure-early-with-terraform-check-blocks-and-assertions/https://devopsaitoolkit.com/blog/catching-bad-infrastructure-early-with-terraform-check-blocks-and-assertions/Validation, preconditions, postconditions, and check blocks each catch failures at a different moment. Knowing which to use where prevents a lot of 2am surprises.Sun, 14 Jun 2026 00:00:00 GMTterraformterraformvalidationcheck-blocksassertionstestingreliabilityhttps://devopsaitoolkit.com/blog/cdk8s-generating-kubernetes-manifests-with-real-code/https://devopsaitoolkit.com/blog/cdk8s-generating-kubernetes-manifests-with-real-code/YAML sprawl and Helm's templating soup both fail at scale. CDK8s lets you define Kubernetes manifests in TypeScript or Python with types, loops, and abstraction.Sun, 14 Jun 2026 00:00:00 GMTiaciaccdk8skubernetesmanifeststypescripthelmhttps://devopsaitoolkit.com/blog/confidence-gated-auto-remediation-safe-patterns/https://devopsaitoolkit.com/blog/confidence-gated-auto-remediation-safe-patterns/How to build confidence-gated auto-remediation safely — tiered autonomy, blast-radius scoring, dry-run defaults, and the guardrails that keep automation from making things worse.Sun, 14 Jun 2026 00:00:00 GMTautomationautomationauto-remediationaisreguardrailsreliabilityhttps://devopsaitoolkit.com/blog/configuring-pagerduty-and-opsgenie-for-incident-response/https://devopsaitoolkit.com/blog/configuring-pagerduty-and-opsgenie-for-incident-response/Most paging tools are configured once and never touched again. Here's how to set up services, escalation policies, and routing that actually hold up under load.Sun, 14 Jun 2026 00:00:00 GMTincident-responseincident-responsepagerdutyopsgenieon-callalertingsrehttps://devopsaitoolkit.com/blog/continuous-profiling-with-pyroscope-alongside-prometheus/https://devopsaitoolkit.com/blog/continuous-profiling-with-pyroscope-alongside-prometheus/Metrics tell you a service is slow or hungry; profiling tells you which line of code is to blame. Here's how Grafana Pyroscope adds the fourth pillar next to your Prometheus stack.Sun, 14 Jun 2026 00:00:00 GMTprometheus-monitoringprometheuspyroscopeprofilingperformancegrafanaobservabilityhttps://devopsaitoolkit.com/blog/cpu-affinity-and-core-isolation-on-linux/https://devopsaitoolkit.com/blog/cpu-affinity-and-core-isolation-on-linux/Pinning processes to CPUs and isolating cores can slash tail latency. Here's how to use taskset, isolcpus, and cgroups to control where work runs.Sun, 14 Jun 2026 00:00:00 GMTlinux-adminslinuxcpuperformanceaffinitytuninglatencyhttps://devopsaitoolkit.com/blog/crossplane-providers-managing-multi-cloud-resources-from-kubernetes/https://devopsaitoolkit.com/blog/crossplane-providers-managing-multi-cloud-resources-from-kubernetes/Compositions get the spotlight, but providers are the engine. Here's how Crossplane providers reconcile real cloud resources and how to run them in production.Sun, 14 Jun 2026 00:00:00 GMTiaciaccrossplanekubernetesmulti-cloudproviderscontrol-planehttps://devopsaitoolkit.com/blog/debugging-distroless-pods-with-ephemeral-debug-containers/https://devopsaitoolkit.com/blog/debugging-distroless-pods-with-ephemeral-debug-containers/Your hardened image has no shell, no curl, no ps. Ephemeral containers let you debug a running pod without rebuilding or weakening it.Sun, 14 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesdebuggingkubectlephemeral-containersdistrolesstroubleshootinghttps://devopsaitoolkit.com/blog/debugging-dns-resolution-with-systemd-resolved/https://devopsaitoolkit.com/blog/debugging-dns-resolution-with-systemd-resolved/systemd-resolved quietly took over DNS on most modern distros. Here's how it actually resolves names, and how to debug it when resolution mysteriously breaks.Sun, 14 Jun 2026 00:00:00 GMTlinux-adminslinuxdnssystemdnetworkingtroubleshootingresolvedhttps://devopsaitoolkit.com/blog/dependency-mapping-a-service-catalog-for-incident-response/https://devopsaitoolkit.com/blog/dependency-mapping-a-service-catalog-for-incident-response/When a service goes down at 3am, the first question is 'what else does this take with it?' A dependency map answers it before you have to guess.Sun, 14 Jun 2026 00:00:00 GMTincident-responseincident-responsedependenciesservice-catalogsrearchitecturereliabilityhttps://devopsaitoolkit.com/blog/deploy-notifications-in-slack-with-context-that-actually-helps/https://devopsaitoolkit.com/blog/deploy-notifications-in-slack-with-context-that-actually-helps/A bare 'deploy succeeded' message is noise. A deploy notification with diff, author, environment, and a rollback button is a tool. Here's how to build the second kind.Sun, 14 Jun 2026 00:00:00 GMTslackslackdeploymentsci-cdblock-kitdevopschatopshttps://devopsaitoolkit.com/blog/designing-an-incident-severity-matrix-impact-versus-urgency/https://devopsaitoolkit.com/blog/designing-an-incident-severity-matrix-impact-versus-urgency/A flat SEV1-SEV4 list breaks down the moment two incidents disagree on severity. Build a two-axis impact-versus-urgency matrix instead.Sun, 14 Jun 2026 00:00:00 GMTincident-responseincident-responsesreon-callseverityprocessreliabilityhttps://devopsaitoolkit.com/blog/devops-on-call-runbook-types-a-2026-field-guide/https://devopsaitoolkit.com/blog/devops-on-call-runbook-types-a-2026-field-guide/A field guide to DevOps on-call runbook types — diagnostic, remediation, deployment, maintenance — plus automation formats, escalation logic, and runbook vs. playbook vs. SOP.Sun, 14 Jun 2026 00:00:00 GMTincident-responseincident-responserunbookson-callsreautomationmttrhttps://devopsaitoolkit.com/blog/distributing-python-cli-tools-with-pipx/https://devopsaitoolkit.com/blog/distributing-python-cli-tools-with-pipx/pip install for a CLI tool pollutes environments and breaks on dependency conflicts. pipx gives every tool its own isolated venv with the command on your PATH.Sun, 14 Jun 2026 00:00:00 GMTbash-python-automationbashpythonpipxclipackagingtoolinghttps://devopsaitoolkit.com/blog/dynamic-child-pipelines-in-gitlab-generating-yaml-on-the-fly/https://devopsaitoolkit.com/blog/dynamic-child-pipelines-in-gitlab-generating-yaml-on-the-fly/When a static .gitlab-ci.yml can't express your pipeline, generate one. Dynamic child pipelines build CI config at runtime. Here's how to do it without chaos.Sun, 14 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdpipelinesmonorepoautomationdevopshttps://devopsaitoolkit.com/blog/encrypting-terraform-state-at-the-source-with-opentofu-state-encryption/https://devopsaitoolkit.com/blog/encrypting-terraform-state-at-the-source-with-opentofu-state-encryption/Backend encryption protects state at rest, but OpenTofu encrypts state before it ever leaves your machine. Here's how client-side state encryption actually works.Sun, 14 Jun 2026 00:00:00 GMTterraformterraformopentofustateencryptionsecuritysecretshttps://devopsaitoolkit.com/blog/enforcing-kubernetes-policy-with-kyverno-admission-rules/https://devopsaitoolkit.com/blog/enforcing-kubernetes-policy-with-kyverno-admission-rules/Reviews catch bad manifests inconsistently. Kyverno enforces your rules at admission time, in YAML, with no Rego to learn.Sun, 14 Jun 2026 00:00:00 GMTkubernetes-helmkuberneteskyvernopolicysecurityadmission-controlgovernancehttps://devopsaitoolkit.com/blog/event-driven-automation-stackstorm-rundeck/https://devopsaitoolkit.com/blog/event-driven-automation-stackstorm-rundeck/How to build event-driven ops automation with StackStorm and Rundeck — sensors, rules, workflows, and AI-assisted triggers that act on events safely.Sun, 14 Jun 2026 00:00:00 GMTautomationautomationstackstormrundeckevent-drivensreorchestrationhttps://devopsaitoolkit.com/blog/event-driven-autoscaling-in-kubernetes-with-keda/https://devopsaitoolkit.com/blog/event-driven-autoscaling-in-kubernetes-with-keda/CPU-based autoscaling can't see your queue backlog. KEDA scales on the metric that actually matters — and can scale all the way to zero.Sun, 14 Jun 2026 00:00:00 GMTkubernetes-helmkuberneteskedaautoscalinghpascalingmessaginghttps://devopsaitoolkit.com/blog/exploring-proc-and-sys-on-linux/https://devopsaitoolkit.com/blog/exploring-proc-and-sys-on-linux/The /proc and /sys filesystems expose the kernel's live state as files. Here's a practical tour of the entries that solve real troubleshooting problems.Sun, 14 Jun 2026 00:00:00 GMTlinux-adminslinuxprocsysfskerneltroubleshootinginternalshttps://devopsaitoolkit.com/blog/follow-the-sun-on-call-coverage-across-time-zones/https://devopsaitoolkit.com/blog/follow-the-sun-on-call-coverage-across-time-zones/Nobody should be paged at 3am if a teammate across the world is mid-afternoon. Here's how to build follow-the-sun on-call that actually hands off cleanly.Sun, 14 Jun 2026 00:00:00 GMTincident-responseincident-responseon-callsreremoteprocessreliabilityhttps://devopsaitoolkit.com/blog/gitlab-ci-variables-and-environments-hygiene-a-practical-guide/https://devopsaitoolkit.com/blog/gitlab-ci-variables-and-environments-hygiene-a-practical-guide/Sprawling CI variables and undisciplined environments are where pipelines rot. Here's how I keep variable scope, protection and environments clean as teams grow.Sun, 14 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdvariablesenvironmentssecuritydevopshttps://devopsaitoolkit.com/blog/gitlab-ci-with-hashicorp-vault-dynamic-secrets-done-right/https://devopsaitoolkit.com/blog/gitlab-ci-with-hashicorp-vault-dynamic-secrets-done-right/Stop pasting static credentials into CI variables. GitLab's native Vault integration uses JWT auth to fetch short-lived secrets at job runtime. Here's the setup.Sun, 14 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdvaultsecretssecuritydevopshttps://devopsaitoolkit.com/blog/gitlab-container-registry-cleanup-policies-stop-paying-for-dead-images/https://devopsaitoolkit.com/blog/gitlab-container-registry-cleanup-policies-stop-paying-for-dead-images/Every CI run pushes images you'll never use again. Without cleanup policies, the registry grows forever. Here's how to set up sane automated tag retention.Sun, 14 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdcontainer-registrydockercost-optimizationdevopshttps://devopsaitoolkit.com/blog/gitops-automation-pipelines-with-argocd-and-flux/https://devopsaitoolkit.com/blog/gitops-automation-pipelines-with-argocd-and-flux/How to build GitOps automation pipelines with Argo CD or Flux — declarative sync, drift detection, progressive delivery, and AI-assisted PR review with safe guardrails.Sun, 14 Jun 2026 00:00:00 GMTautomationautomationgitopsargocdfluxkubernetesci-cdhttps://devopsaitoolkit.com/blog/humanizing-ai-for-infrastructure-automation-building-trust/https://devopsaitoolkit.com/blog/humanizing-ai-for-infrastructure-automation-building-trust/How DevOps teams build trust in AI for infrastructure automation — across Terraform, Ansible, and GitLab pipelines — using policy checks, rollback plans, and verifiable, reviewable output instead of black-box magic.Sun, 14 Jun 2026 00:00:00 GMTautomationautomationterraformansiblegitlab-cicdpolicy-as-codehuman-in-the-loophttps://devopsaitoolkit.com/blog/humanizing-ai-in-incident-response-explain-not-just-automate/https://devopsaitoolkit.com/blog/humanizing-ai-in-incident-response-explain-not-just-automate/Explainable AI in incident response beats black-box automation. Why DevOps teams need AI that shows its reasoning, generates step-by-step remediation, and keeps a human in the approval loop — not a bot that acts on its own.Sun, 14 Jun 2026 00:00:00 GMTincident-responseincident-responseexplainable-aihuman-in-the-loopsreremediationautomationhttps://devopsaitoolkit.com/blog/humanizing-artificial-intelligence-for-devops-automation-engineers-in-control/https://devopsaitoolkit.com/blog/humanizing-artificial-intelligence-for-devops-automation-engineers-in-control/How DevOps teams use AI to generate scripts, review infrastructure code, and suggest fixes — while engineers stay the final decision-makers. A practical guide to human-in-control AI automation workflows.Sun, 14 Jun 2026 00:00:00 GMTautomationautomationhuman-in-the-loopdevopscode-reviewscriptingai-workflowshttps://devopsaitoolkit.com/blog/identifying-and-eliminating-toil-with-ai/https://devopsaitoolkit.com/blog/identifying-and-eliminating-toil-with-ai/A practical method for finding the toil hiding in your team's week and automating it away — measuring toil, prioritizing by ROI, and using AI to draft the automation.Sun, 14 Jun 2026 00:00:00 GMTautomationautomationtoilsreproductivityaidevopshttps://devopsaitoolkit.com/blog/immutable-infrastructure-patterns-stop-patching-start-replacing/https://devopsaitoolkit.com/blog/immutable-infrastructure-patterns-stop-patching-start-replacing/Mutable servers drift, accumulate cruft, and fail unpredictably. Immutable infrastructure trades in-place changes for replacement — here's how to actually adopt it.Sun, 14 Jun 2026 00:00:00 GMTiaciacimmutable-infrastructuredeploymentgolden-imagesreliabilitydevopshttps://devopsaitoolkit.com/blog/incident-metrics-that-matter-mtta-mttr-mtbf/https://devopsaitoolkit.com/blog/incident-metrics-that-matter-mtta-mttr-mtbf/A wall of incident KPIs that nobody acts on is just decoration. Here's which metrics actually drive reliability improvements and how to measure them honestly.Sun, 14 Jun 2026 00:00:00 GMTincident-responseincident-responsemetricssremttrreliabilityobservabilityhttps://devopsaitoolkit.com/blog/instance-high-availability-with-openstack-masakari/https://devopsaitoolkit.com/blog/instance-high-availability-with-openstack-masakari/When a compute node dies, Masakari evacuates its VMs automatically instead of paging you. Here's how I run Masakari in production so a dead host self-heals.Sun, 14 Jun 2026 00:00:00 GMTopenstackopenstackmasakarihigh-availabilitynovaevacuationdevopshttps://devopsaitoolkit.com/blog/instrumenting-python-scripts-with-prometheus-client/https://devopsaitoolkit.com/blog/instrumenting-python-scripts-with-prometheus-client/Your automation script runs fine until it silently doesn't. Adding Prometheus metrics turns invisible cron jobs into things you can actually alert on.Sun, 14 Jun 2026 00:00:00 GMTbash-python-automationbashpythonprometheusmonitoringmetricsobservabilityhttps://devopsaitoolkit.com/blog/keyless-image-signing-with-cosign-and-sigstore/https://devopsaitoolkit.com/blog/keyless-image-signing-with-cosign-and-sigstore/Long-lived signing keys leak. Sigstore's keyless flow ties a signature to an OIDC identity instead. Here's how to sign and verify images for real.Sun, 14 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningsigstorecosignsupply-chainkuberneteshttps://devopsaitoolkit.com/blog/learning-from-near-misses-before-they-become-outages/https://devopsaitoolkit.com/blog/learning-from-near-misses-before-they-become-outages/The disk that almost filled. The deploy you caught in staging. Near-misses are free lessons most teams throw away — here's how to harvest them.Sun, 14 Jun 2026 00:00:00 GMTincident-responseincident-responsenear-misssrereliabilitysafetyprocesshttps://devopsaitoolkit.com/blog/loop-components-in-teams-shared-runbooks-that-stay-in-sync/https://devopsaitoolkit.com/blog/loop-components-in-teams-shared-runbooks-that-stay-in-sync/Loop components are live, editable chunks that stay synced everywhere they're pasted. Here's how DevOps teams use them for runbooks, checklists, and incident tracking.Sun, 14 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsloop-componentscollaborationdevopsrunbooksincident-responsehttps://devopsaitoolkit.com/blog/managing-glance-images-at-scale-in-openstack/https://devopsaitoolkit.com/blog/managing-glance-images-at-scale-in-openstack/Image sprawl quietly eats storage and slows boots. Here's how I run Glance at scale — backends, image properties, caching, and a cleanup discipline that holds.Sun, 14 Jun 2026 00:00:00 GMTopenstackopenstackglanceimagesstoragecephdevopshttps://devopsaitoolkit.com/blog/managing-linux-kernel-modules-with-modprobe/https://devopsaitoolkit.com/blog/managing-linux-kernel-modules-with-modprobe/Kernel modules load drivers and features on demand. Here's how to inspect, load, blacklist, and configure modules safely without breaking boot.Sun, 14 Jun 2026 00:00:00 GMTlinux-adminslinuxkernelmodulesmodprobedriverstroubleshootinghttps://devopsaitoolkit.com/blog/managing-manila-shared-filesystems-in-openstack/https://devopsaitoolkit.com/blog/managing-manila-shared-filesystems-in-openstack/Manila gives OpenStack tenants real shared filesystems — NFS and CIFS that survive instance churn. Here's how I run it in production without the share-server sprawl biting me.Sun, 14 Jun 2026 00:00:00 GMTopenstackopenstackmanilashared-filesystemsnfsstoragedevopshttps://devopsaitoolkit.com/blog/managing-software-raid-with-mdadm/https://devopsaitoolkit.com/blog/managing-software-raid-with-mdadm/Software RAID with mdadm is rock-solid when you understand it. Here's how to build arrays, monitor health, and recover from a failed disk without losing data.Sun, 14 Jun 2026 00:00:00 GMTlinux-adminslinuxraidmdadmstoragedisksrecoveryhttps://devopsaitoolkit.com/blog/mastering-rules-changes-in-gitlab-ci-path-scoped-pipelines/https://devopsaitoolkit.com/blog/mastering-rules-changes-in-gitlab-ci-path-scoped-pipelines/rules:changes can cut wasted CI dramatically — or silently skip the tests that matter. Here's how to path-scope pipelines correctly without dangerous false negatives.Sun, 14 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdrulesmonorepoperformancedevopshttps://devopsaitoolkit.com/blog/message-scheduling-and-reminders-for-slack-ops-bots/https://devopsaitoolkit.com/blog/message-scheduling-and-reminders-for-slack-ops-bots/Scheduled messages and reminders turn a reactive bot into a proactive one — maintenance windows, cert expiry, on-call nudges. Here's how to use them without spam.Sun, 14 Jun 2026 00:00:00 GMTslackslackschedulingremindersautomationdevopschatopshttps://devopsaitoolkit.com/blog/metric-naming-standards-that-keep-prometheus-sane/https://devopsaitoolkit.com/blog/metric-naming-standards-that-keep-prometheus-sane/Inconsistent metric names turn dashboards and alerts into archaeology. A naming convention for units, suffixes, and labels makes every metric predictable and queryable.Sun, 14 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusmetric-naminginstrumentationstandardspromqlobservabilityhttps://devopsaitoolkit.com/blog/microsoft-graph-change-notifications-event-driven-teams-automation/https://devopsaitoolkit.com/blog/microsoft-graph-change-notifications-event-driven-teams-automation/Stop polling Graph on a timer. Change notifications push events to your webhook when channels, messages, and teams change — here's how to wire them safely.Sun, 14 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsmicrosoft-graphwebhooksevent-drivendevopsautomationhttps://devopsaitoolkit.com/blog/modern-linux-networking-with-iproute2/https://devopsaitoolkit.com/blog/modern-linux-networking-with-iproute2/ifconfig and route have been deprecated for years. Here's the iproute2 toolset every Linux admin should know, with the ip commands that replace the old ones.Sun, 14 Jun 2026 00:00:00 GMTlinux-adminslinuxnetworkingiproute2ip-commandroutingtroubleshootinghttps://devopsaitoolkit.com/blog/multi-window-burn-rate-alerts-for-slos-that-work/https://devopsaitoolkit.com/blog/multi-window-burn-rate-alerts-for-slos-that-work/Single-threshold error alerts either page too late or too often. Multi-window multi-burn-rate alerting catches fast disasters and slow leaks without crying wolf. Here's the PromQL.Sun, 14 Jun 2026 00:00:00 GMTprometheus-monitoringprometheussloalertingburn-rateerror-budgetsrehttps://devopsaitoolkit.com/blog/n8n-for-devops-workflow-automation/https://devopsaitoolkit.com/blog/n8n-for-devops-workflow-automation/How DevOps teams use n8n to automate glue work — webhooks, on-call workflows, AI-assisted triage — with self-hosting, credentials, and guardrails done right.Sun, 14 Jun 2026 00:00:00 GMTautomationautomationn8nworkflowsdevopsaichatopshttps://devopsaitoolkit.com/blog/nixos-for-servers-truly-reproducible-infrastructure/https://devopsaitoolkit.com/blog/nixos-for-servers-truly-reproducible-infrastructure/Most IaC describes desired state and hopes the package manager cooperates. NixOS makes the entire OS a single declarative artifact you can roll back instantly.Sun, 14 Jun 2026 00:00:00 GMTiaciacnixosnixreproducibilityimmutabledeclarativehttps://devopsaitoolkit.com/blog/oidc-keyless-cloud-auth-in-ci-killing-long-lived-credentials/https://devopsaitoolkit.com/blog/oidc-keyless-cloud-auth-in-ci-killing-long-lived-credentials/Static cloud keys in CI secrets are the breach waiting to happen. OIDC federation swaps them for short-lived tokens. Here's how to cut them over.Sun, 14 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningoidcci-cdiamcloudhttps://devopsaitoolkit.com/blog/opa-gatekeeper-vs-kyverno-choosing-a-policy-engine/https://devopsaitoolkit.com/blog/opa-gatekeeper-vs-kyverno-choosing-a-policy-engine/Both engines block bad pods at admission time. The real question is which one your team can write, debug, and live with. Here's an honest comparison.Sun, 14 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningkubernetesopakyvernoadmission-controlhttps://devopsaitoolkit.com/blog/optimizing-resource-usage-with-openstack-watcher/https://devopsaitoolkit.com/blog/optimizing-resource-usage-with-openstack-watcher/Watcher is OpenStack's optimization engine — it consolidates VMs, balances load, and saves power. Here's how I drive it in production without it live-migrating my cloud into a wall.Sun, 14 Jun 2026 00:00:00 GMTopenstackopenstackwatcheroptimizationlive-migrationcapacitydevopshttps://devopsaitoolkit.com/blog/orchestrating-multi-project-pipelines-in-gitlab/https://devopsaitoolkit.com/blog/orchestrating-multi-project-pipelines-in-gitlab/When one repo's pipeline needs to trigger another, GitLab bridges and the needs:project keyword keep things clean. Here's how to wire cross-project CI sanely.Sun, 14 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdmulti-projectpipelinesmicroservicesdevopshttps://devopsaitoolkit.com/blog/orchestrating-workflows-with-temporal-and-argo/https://devopsaitoolkit.com/blog/orchestrating-workflows-with-temporal-and-argo/When to reach for Temporal vs Argo Workflows for durable ops orchestration — retries, idempotency, human approval steps, and AI-assisted automation done safely.Sun, 14 Jun 2026 00:00:00 GMTautomationautomationtemporalargo-workflowsorchestrationkubernetessrehttps://devopsaitoolkit.com/blog/per-project-environments-with-direnv-for-ops-work/https://devopsaitoolkit.com/blog/per-project-environments-with-direnv-for-ops-work/Stop exporting AWS_PROFILE by hand and forgetting to unset it. direnv loads the right env vars when you cd in and unloads them when you leave.Sun, 14 Jun 2026 00:00:00 GMTbash-python-automationbashpythondirenvenvironmenttoolingworkflowhttps://devopsaitoolkit.com/blog/pod-disruption-budgets-keeping-services-up-during-cluster-maintenance/https://devopsaitoolkit.com/blog/pod-disruption-budgets-keeping-services-up-during-cluster-maintenance/A node drain can take your whole service down if you let it. Pod Disruption Budgets tell Kubernetes how much availability it must preserve.Sun, 14 Jun 2026 00:00:00 GMTkubernetes-helmkubernetespdbavailabilityreliabilitynode-maintenancesrehttps://devopsaitoolkit.com/blog/pod-security-standards-and-admission-hardening-in-practice/https://devopsaitoolkit.com/blog/pod-security-standards-and-admission-hardening-in-practice/Most pods run with privileges they never use. Pod Security Standards close that gap. Here's how to enforce restricted profiles without breaking your apps.Sun, 14 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningkubernetespod-securityadmission-controlcontainershttps://devopsaitoolkit.com/blog/processing-huge-files-with-awk-and-streaming/https://devopsaitoolkit.com/blog/processing-huge-files-with-awk-and-streaming/When a log file is bigger than your memory, loading it into a list is the wrong move. Here's how to stream multi-gigabyte files with awk and Python generators.Sun, 14 Jun 2026 00:00:00 GMTbash-python-automationbashpythonawkstreamingperformancedatahttps://devopsaitoolkit.com/blog/prometheus-exemplars-and-trace-links-metrics-to-traces/https://devopsaitoolkit.com/blog/prometheus-exemplars-and-trace-links-metrics-to-traces/A latency spike on a dashboard tells you something is slow but not which request. Exemplars bridge metrics to traces so one click jumps from a p99 bump to the exact slow trace.Sun, 14 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusexemplarstracingopentelemetrygrafanaobservabilityhttps://devopsaitoolkit.com/blog/prometheus-operator-and-kube-prometheus-stack-explained/https://devopsaitoolkit.com/blog/prometheus-operator-and-kube-prometheus-stack-explained/Stop hand-editing prometheus.yml in Kubernetes. The Prometheus Operator turns scrape config and alerts into CRDs. Here's how ServiceMonitors and the stack actually fit together.Sun, 14 Jun 2026 00:00:00 GMTprometheus-monitoringprometheuskubernetesoperatorhelmservicemonitorobservabilityhttps://devopsaitoolkit.com/blog/prometheus-scrape-config-and-relabeling-deep-dive/https://devopsaitoolkit.com/blog/prometheus-scrape-config-and-relabeling-deep-dive/Relabeling is the most powerful and most confusing part of Prometheus. Master relabel_configs and metric_relabel_configs to control targets, labels, and cardinality.Sun, 14 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusrelabelingscrape-configservice-discoverycardinalityobservabilityhttps://devopsaitoolkit.com/blog/provider-defined-functions-the-terraform-feature-that-kills-your-locals-sprawl/https://devopsaitoolkit.com/blog/provider-defined-functions-the-terraform-feature-that-kills-your-locals-sprawl/Terraform's built-in functions can't do everything, so people build grotesque locals to parse ARNs and encode JWTs. Provider-defined functions fix that. Here's how.Sun, 14 Jun 2026 00:00:00 GMTterraformterraformfunctionsprovidershclexpressionsclean-codehttps://devopsaitoolkit.com/blog/publishing-teams-apps-the-manifest-and-app-catalog-workflow/https://devopsaitoolkit.com/blog/publishing-teams-apps-the-manifest-and-app-catalog-workflow/Your bot works in sideload but won't install for the team. The gap is the app manifest and the catalog approval flow — here's the path from dev to org-wide.Sun, 14 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsapp-manifestpublishingdevopsgovernanceci-cdhttps://devopsaitoolkit.com/blog/pulumi-automation-api-infrastructure-as-a-real-program/https://devopsaitoolkit.com/blog/pulumi-automation-api-infrastructure-as-a-real-program/The CLI is fine for humans. When you need to provision infra from your own app or platform, the Pulumi Automation API turns deployments into function calls.Sun, 14 Jun 2026 00:00:00 GMTiaciacpulumiautomation-apiplatform-engineeringself-servicegolanghttps://devopsaitoolkit.com/blog/remote-automation-in-python-with-paramiko-and-fabric/https://devopsaitoolkit.com/blog/remote-automation-in-python-with-paramiko-and-fabric/When Ansible is too heavy and a bash for-loop over SSH is too fragile, Paramiko and Fabric hit the sweet spot. Here's how to drive remote hosts from Python safely.Sun, 14 Jun 2026 00:00:00 GMTbash-python-automationbashpythonsshparamikofabricautomationhttps://devopsaitoolkit.com/blog/resilient-http-in-python-with-httpx-retry-sessions/https://devopsaitoolkit.com/blog/resilient-http-in-python-with-httpx-retry-sessions/A bare requests.get against a flaky API will eventually page you. Connection pooling, timeouts, and retry transports turn fragile scripts into reliable ones.Sun, 14 Jun 2026 00:00:00 GMTbash-python-automationbashpythonhttpxrequestshttpreliabilityhttps://devopsaitoolkit.com/blog/right-sizing-pods-automatically-with-the-vertical-pod-autoscaler/https://devopsaitoolkit.com/blog/right-sizing-pods-automatically-with-the-vertical-pod-autoscaler/Most teams guess at CPU and memory requests and never revisit them. The Vertical Pod Autoscaler measures real usage and tells you what to set.Sun, 14 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesvpaautoscalingresourcescost-optimizationperformancehttps://devopsaitoolkit.com/blog/running-ansible-awx-for-self-service-infrastructure-automation/https://devopsaitoolkit.com/blog/running-ansible-awx-for-self-service-infrastructure-automation/Ad-hoc playbook runs from someone's laptop don't scale. Here's how to stand up AWX so teams can run automation safely, with audit trails and RBAC.Sun, 14 Jun 2026 00:00:00 GMTansibleiacansibleawxautomationself-servicerbachttps://devopsaitoolkit.com/blog/running-database-as-a-service-with-openstack-trove/https://devopsaitoolkit.com/blog/running-database-as-a-service-with-openstack-trove/Trove gives tenants self-service databases — MySQL, PostgreSQL, more — with backups and replication. Here's how I run it in production without the guest-agent pain.Sun, 14 Jun 2026 00:00:00 GMTopenstackopenstacktrovedbaasmysqlpostgresqldevopshttps://devopsaitoolkit.com/blog/running-grafana-mimir-at-scale-multi-tenant-metrics/https://devopsaitoolkit.com/blog/running-grafana-mimir-at-scale-multi-tenant-metrics/Mimir promises a billion active series and multi-tenancy, but its microservices sprawl bites teams that deploy it naively. Here's how to run it without drowning in components.Sun, 14 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusmimirscalingmulti-tenancyremote-writeobservabilityhttps://devopsaitoolkit.com/blog/running-incident-retrospectives-a-facilitators-template/https://devopsaitoolkit.com/blog/running-incident-retrospectives-a-facilitators-template/Writing the postmortem doc is the easy part. Running the meeting where the team actually learns is the hard part. Here's a facilitator's playbook.Sun, 14 Jun 2026 00:00:00 GMTpostmortemsincident-responseretrospectivepostmortemsrefacilitationprocesshttps://devopsaitoolkit.com/blog/saltstack-states-event-driven-configuration-management-at-scale/https://devopsaitoolkit.com/blog/saltstack-states-event-driven-configuration-management-at-scale/Salt's reputation is speed, but its real edge is the event bus and reactor. Here's how to write maintainable states and automate responses across thousands of nodes.Sun, 14 Jun 2026 00:00:00 GMTiaciacsaltstackconfiguration-managementevent-drivenautomationscalehttps://devopsaitoolkit.com/blog/scaffold-teams-apps-faster-with-the-teams-toolkit-dev-workflow/https://devopsaitoolkit.com/blog/scaffold-teams-apps-faster-with-the-teams-toolkit-dev-workflow/The Teams Toolkit turns a week of manifest fiddling and tunnel setup into an afternoon. Here's the dev workflow I actually use to ship DevOps apps.Sun, 14 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsteams-toolkitdevopsdeveloper-experiencevscodeci-cdhttps://devopsaitoolkit.com/blog/scaling-argocd-with-the-app-of-apps-pattern/https://devopsaitoolkit.com/blog/scaling-argocd-with-the-app-of-apps-pattern/Managing a hundred Argo CD applications by hand doesn't scale. The app-of-apps pattern lets one root application bootstrap your entire fleet.Sun, 14 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesargocdgitopsapp-of-appsci-cdhelmhttps://devopsaitoolkit.com/blog/scaling-nova-with-cells-v2-in-openstack/https://devopsaitoolkit.com/blog/scaling-nova-with-cells-v2-in-openstack/Cells v2 lets a single Nova deployment scale to thousands of compute nodes by sharding the database and message queue. Here's how I plan and run a multi-cell cloud.Sun, 14 Jun 2026 00:00:00 GMTopenstackopenstacknovacells-v2scalingdatabasedevopshttps://devopsaitoolkit.com/blog/scheduled-job-orchestration-at-scale/https://devopsaitoolkit.com/blog/scheduled-job-orchestration-at-scale/How to run scheduled jobs reliably at scale — dependencies, retries, idempotency, observability — with Kubernetes CronJobs, Airflow, and AI-assisted failure triage.Sun, 14 Jun 2026 00:00:00 GMTautomationautomationcronschedulingairflowkubernetesorchestrationhttps://devopsaitoolkit.com/blog/scheduled-pipelines-in-gitlab-nightly-builds-and-cron-jobs-done-right/https://devopsaitoolkit.com/blog/scheduled-pipelines-in-gitlab-nightly-builds-and-cron-jobs-done-right/GitLab pipeline schedules turn your CI into a reliable cron with audit trails. Here's how I run nightly tests, dependency updates and cleanups without surprises.Sun, 14 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdpipelinesautomationcrondevopshttps://devopsaitoolkit.com/blog/scripting-aws-with-boto3-without-the-rough-edges/https://devopsaitoolkit.com/blog/scripting-aws-with-boto3-without-the-rough-edges/boto3 makes the AWS API one import away, which is exactly why it's easy to write slow, fragile, or expensive scripts. Here are the patterns that keep them sane.Sun, 14 Jun 2026 00:00:00 GMTbash-python-automationbashpythonawsboto3cloudautomationhttps://devopsaitoolkit.com/blog/seccomp-and-apparmor-profiles-shrinking-the-container-attack-surface/https://devopsaitoolkit.com/blog/seccomp-and-apparmor-profiles-shrinking-the-container-attack-surface/A container can call hundreds of syscalls it never needs. Seccomp and AppArmor strip that surface down. Here's how to profile and lock down workloads safely.Sun, 14 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningseccompapparmorcontainerskuberneteshttps://devopsaitoolkit.com/blog/service-mesh-mtls-istio-vs-linkerd-for-zero-trust-traffic/https://devopsaitoolkit.com/blog/service-mesh-mtls-istio-vs-linkerd-for-zero-trust-traffic/Plaintext east-west traffic is a gift to an attacker who's already inside. A mesh gives you automatic mTLS. Here's how to roll it out without an outage.Sun, 14 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningmtlsservice-meshistiolinkerdhttps://devopsaitoolkit.com/blog/setting-linux-resource-limits-with-ulimit-and-systemd/https://devopsaitoolkit.com/blog/setting-linux-resource-limits-with-ulimit-and-systemd/Too many open files and runaway processes come down to resource limits. Here's how ulimit, limits.conf, and systemd directives really interact.Sun, 14 Jun 2026 00:00:00 GMTlinux-adminslinuxulimitrlimitssystemdtuningtroubleshootinghttps://devopsaitoolkit.com/blog/setting-up-keystone-federation-in-openstack/https://devopsaitoolkit.com/blog/setting-up-keystone-federation-in-openstack/Federation lets users log into OpenStack with an external IdP — SAML or OIDC — instead of local Keystone accounts. Here's how I set it up and map identities in production.Sun, 14 Jun 2026 00:00:00 GMTopenstackopenstackkeystonefederationssooidcsamldevopshttps://devopsaitoolkit.com/blog/sharing-data-between-terraform-configurations-without-creating-a-mess/https://devopsaitoolkit.com/blog/sharing-data-between-terraform-configurations-without-creating-a-mess/Remote state data sources are the obvious way to share outputs between configs, and the easiest way to build a brittle dependency web. Here are the safer patterns.Sun, 14 Jun 2026 00:00:00 GMTterraformterraformremote-stateoutputsmodulesarchitecturecouplinghttps://devopsaitoolkit.com/blog/slack-modals-and-interactive-components-for-ops-tooling/https://devopsaitoolkit.com/blog/slack-modals-and-interactive-components-for-ops-tooling/Slash commands are fine for simple actions, but real ops workflows need input. Here's how to use modals, select menus, and multi-step views to build serious tooling.Sun, 14 Jun 2026 00:00:00 GMTslackslackmodalsblock-kitinteractivitydevopschatopshttps://devopsaitoolkit.com/blog/slack-notifications-for-terraform-cloud-runs/https://devopsaitoolkit.com/blog/slack-notifications-for-terraform-cloud-runs/Terraform Cloud can fire run events at Slack, but the default payloads are thin. Here's how to turn plan and apply events into reviewable, actionable messages.Sun, 14 Jun 2026 00:00:00 GMTslackslackterraforminfrastructure-as-codeiacdevopsautomationhttps://devopsaitoolkit.com/blog/slack-threading-strategy-for-incident-response/https://devopsaitoolkit.com/blog/slack-threading-strategy-for-incident-response/An incident channel without a threading discipline becomes an unreadable wall by minute ten. Here's the threading strategy that keeps the timeline legible under pressure.Sun, 14 Jun 2026 00:00:00 GMTslackslackincident-responsethreadingsreon-callchatopshttps://devopsaitoolkit.com/blog/slsa-supply-chain-levels-a-practical-roadmap/https://devopsaitoolkit.com/blog/slsa-supply-chain-levels-a-practical-roadmap/SLSA is a maturity ladder for build integrity, not a checkbox. Here's what each level actually demands and how to climb it without boiling the ocean.Sun, 14 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningslsasupply-chainci-cdprovenancehttps://devopsaitoolkit.com/blog/socket-mode-vs-events-api-choosing-the-right-slack-transport/https://devopsaitoolkit.com/blog/socket-mode-vs-events-api-choosing-the-right-slack-transport/Socket Mode and the Events API solve the same problem two different ways. Picking wrong costs you a public endpoint, scaling pain, or both. Here's how I decide.Sun, 14 Jun 2026 00:00:00 GMTslackslacksocket-modeevents-apiarchitecturedevopschatopshttps://devopsaitoolkit.com/blog/spacelift-vs-env0-choosing-a-terraform-automation-platform/https://devopsaitoolkit.com/blog/spacelift-vs-env0-choosing-a-terraform-automation-platform/Both promise managed Terraform runs, policy gates, and drift detection. The differences only matter once you know what your team actually needs. Here's how to decide.Sun, 14 Jun 2026 00:00:00 GMTterraformterraformspaceliftenv0automationplatformtacoshttps://devopsaitoolkit.com/blog/spreading-pods-across-nodes-and-zones-with-topology-spread-constraints/https://devopsaitoolkit.com/blog/spreading-pods-across-nodes-and-zones-with-topology-spread-constraints/Three replicas on one node is not high availability. Topology spread constraints force Kubernetes to distribute pods across failure domains.Sun, 14 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesschedulingavailabilitytopologyaffinityreliabilityhttps://devopsaitoolkit.com/blog/stop-leaking-secrets-with-terraform-ephemeral-resources-and-write-only-arguments/https://devopsaitoolkit.com/blog/stop-leaking-secrets-with-terraform-ephemeral-resources-and-write-only-arguments/Terraform has always written your secrets to state in plaintext. Ephemeral resources and write-only arguments finally close that hole. Here's how to use both.Sun, 14 Jun 2026 00:00:00 GMTterraformterraformsecretsephemeralsecuritystatewrite-onlyhttps://devopsaitoolkit.com/blog/stopping-secret-leaks-before-they-hit-git-history/https://devopsaitoolkit.com/blog/stopping-secret-leaks-before-they-hit-git-history/A leaked credential in Git is forever, even after you delete the line. Here's how to block secrets at commit, in CI, and across history with layered scanning.Sun, 14 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningsecretsgitci-cddetectionhttps://devopsaitoolkit.com/blog/syncing-secrets-into-kubernetes-with-the-external-secrets-operator/https://devopsaitoolkit.com/blog/syncing-secrets-into-kubernetes-with-the-external-secrets-operator/Storing secrets in Git is a breach waiting to happen. Here's how External Secrets Operator pulls them from a real secret store into your cluster safely.Sun, 14 Jun 2026 00:00:00 GMTkubernetes-helmkubernetessecretssecurityexternal-secretsvaultgitopshttps://devopsaitoolkit.com/blog/taming-the-linux-oom-killer/https://devopsaitoolkit.com/blog/taming-the-linux-oom-killer/The OOM killer always seems to kill the wrong process. Here's how Linux decides what to kill, and how to tune oom_score, cgroups, and overcommit to control it.Sun, 14 Jun 2026 00:00:00 GMTlinux-adminslinuxmemoryoomcgroupsperformancetuninghttps://devopsaitoolkit.com/blog/taming-the-terraform-lock-file-and-version-constraints-for-real/https://devopsaitoolkit.com/blog/taming-the-terraform-lock-file-and-version-constraints-for-real/The .terraform.lock.hcl file and version constraints quietly decide whether your applies are reproducible. Most teams treat them as noise. Here's how to use them right.Sun, 14 Jun 2026 00:00:00 GMTterraformterraformlock-fileversioningprovidersreproducibilitycihttps://devopsaitoolkit.com/blog/teams-activity-feed-notifications-from-graph-for-devops-alerts/https://devopsaitoolkit.com/blog/teams-activity-feed-notifications-from-graph-for-devops-alerts/Channel posts get buried. Activity feed notifications put a personal, deep-linked alert in the recipient's bell — here's how to send them from Graph.Sun, 14 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsmicrosoft-graphnotificationsdevopsalertingon-callhttps://devopsaitoolkit.com/blog/teams-connectors-and-workflows-routing-cicd-events-into-channels/https://devopsaitoolkit.com/blog/teams-connectors-and-workflows-routing-cicd-events-into-channels/The Workflows app replaced incoming webhooks. Here's how to route Jenkins, GitHub, and Prometheus events into Teams channels with cards people actually read.Sun, 14 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsworkflowsci-cddevopsadaptive-cardsautomationhttps://devopsaitoolkit.com/blog/teams-meeting-apps-for-devops-live-incident-bridges/https://devopsaitoolkit.com/blog/teams-meeting-apps-for-devops-live-incident-bridges/Meeting extensions let you put a live dashboard, action tracker, or runbook right inside the incident bridge. Here's how to build one and the surfaces you get.Sun, 14 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsmeeting-appsincident-responsedevopsadaptive-cardscollaborationhttps://devopsaitoolkit.com/blog/terraform-stacks-explained-for-teams-drowning-in-workspaces/https://devopsaitoolkit.com/blog/terraform-stacks-explained-for-teams-drowning-in-workspaces/Workspaces and copy-pasted root modules don't scale to dozens of environments. Terraform Stacks rethink the unit of deployment. Here's how they actually work.Sun, 14 Jun 2026 00:00:00 GMTterraformterraformstacksiacdeploymentshcpscalinghttps://devopsaitoolkit.com/blog/the-communications-lead-role-in-incident-response/https://devopsaitoolkit.com/blog/the-communications-lead-role-in-incident-response/The incident commander runs the fix. The comms lead runs the narrative. On a real SEV1, you need both — here's what the comms lead actually does.Sun, 14 Jun 2026 00:00:00 GMTincident-responseincident-responsecommunicationsreroleson-callprocesshttps://devopsaitoolkit.com/blog/tuning-the-gitlab-kubernetes-executor-for-fast-reliable-runners/https://devopsaitoolkit.com/blog/tuning-the-gitlab-kubernetes-executor-for-fast-reliable-runners/The Kubernetes executor is the right call for elastic CI, but the defaults will burn you. Here's how I tune resources, concurrency and pod overhead for speed.Sun, 14 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdkubernetesrunnersperformancedevopshttps://devopsaitoolkit.com/blog/victoriametrics-vs-prometheus-when-to-switch-and-why/https://devopsaitoolkit.com/blog/victoriametrics-vs-prometheus-when-to-switch-and-why/Prometheus is the default, but at scale its memory appetite and single-node TSDB start to hurt. Here's an honest comparison with VictoriaMetrics and when to migrate.Sun, 14 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusvictoriametricstsdbscalingobservabilityremote-writehttps://devopsaitoolkit.com/blog/writing-custom-falco-rules-that-catch-real-attacks/https://devopsaitoolkit.com/blog/writing-custom-falco-rules-that-catch-real-attacks/Falco's default rules are a starting point, not a strategy. Here's how to write custom detection rules tuned to your environment without drowning in false positives.Sun, 14 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningfalcoruntime-securitydetectionkuberneteshttps://devopsaitoolkit.com/blog/writing-executive-incident-updates-leadership-will-read/https://devopsaitoolkit.com/blog/writing-executive-incident-updates-leadership-will-read/Executives don't want your stack trace. They want impact, confidence, and the next decision point. Here's how to brief leadership during a live incident.Sun, 14 Jun 2026 00:00:00 GMTincident-responseincident-responsecommunicationleadershipsreprocesson-callhttps://devopsaitoolkit.com/blog/devops-runbook-automation-with-ai-2026-guide/https://devopsaitoolkit.com/blog/devops-runbook-automation-with-ai-2026-guide/How to build AI-driven runbook automation in 2026 — intelligent runbook selection, confidence-gated execution, tiered autonomy, and the governance to run it safely.Sat, 13 Jun 2026 00:00:00 GMTautomationautomationrunbookincident-responseaisreagentic-aihttps://devopsaitoolkit.com/blog/adaptive-card-universal-actions-for-stateful-teams-workflows/https://devopsaitoolkit.com/blog/adaptive-card-universal-actions-for-stateful-teams-workflows/Universal actions let a card update itself for everyone after a button press. Here's how to use Action.Execute and refresh to build real approval and ack flows.Fri, 12 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsadaptive-cardsuniversal-actionsapprovalsbot-frameworkdevopshttps://devopsaitoolkit.com/blog/ai-assisted-kubernetes-troubleshooting-explained/https://devopsaitoolkit.com/blog/ai-assisted-kubernetes-troubleshooting-explained/How AI-assisted Kubernetes troubleshooting works — K8sGPT, kubectl-why, and kubectl debug for faster root-cause analysis, with the governance to run it safely in production.Fri, 12 Jun 2026 00:00:00 GMTkubernetes-helmkubernetestroubleshootingk8sgptaisredebugginghttps://devopsaitoolkit.com/blog/ansible-dynamic-inventory-for-cloud-infrastructure/https://devopsaitoolkit.com/blog/ansible-dynamic-inventory-for-cloud-infrastructure/Static inventory files rot the moment your cloud autoscales. Here's how to wire up dynamic inventory so Ansible always sees the truth — across AWS, GCP, and Azure.Fri, 12 Jun 2026 00:00:00 GMTansibleiacansibledynamic-inventoryawscloudautomationhttps://devopsaitoolkit.com/blog/auditing-linux-server-hardening-with-lynis/https://devopsaitoolkit.com/blog/auditing-linux-server-hardening-with-lynis/Lynis tells you what's weak about a server in two minutes flat. Here's how I use it to drive real hardening instead of chasing a vanity score.Fri, 12 Jun 2026 00:00:00 GMTlinux-adminslinuxlynishardeningsecurityauditingcompliancehttps://devopsaitoolkit.com/blog/automating-ops-with-slack-workflow-builder-no-code-runbooks/https://devopsaitoolkit.com/blog/automating-ops-with-slack-workflow-builder-no-code-runbooks/Workflow Builder turns the boring, repeatable parts of ops into buttons and forms anyone can trigger. Here's how to use it without writing a single line of bot code.Fri, 12 Jun 2026 00:00:00 GMTslackslackworkflow-builderautomationdevopschatopsrunbookshttps://devopsaitoolkit.com/blog/automating-secrets-rotation-without-downtime/https://devopsaitoolkit.com/blog/automating-secrets-rotation-without-downtime/Static credentials that never rotate are a breach waiting to happen. Here's how to automate rotation for database creds, API keys, and certs without a single outage.Fri, 12 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningsecretsrotationvaultautomationhttps://devopsaitoolkit.com/blog/automating-teams-and-channel-provisioning-with-rsc-permissions/https://devopsaitoolkit.com/blog/automating-teams-and-channel-provisioning-with-rsc-permissions/Spin up incident channels and project teams on demand, and let your app act on them with resource-specific consent instead of broad tenant-wide Graph scopes.Fri, 12 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsprovisioningrscgraph-apiautomationincident-responsehttps://devopsaitoolkit.com/blog/aws-cdk-patterns-that-keep-infrastructure-code-maintainable/https://devopsaitoolkit.com/blog/aws-cdk-patterns-that-keep-infrastructure-code-maintainable/The AWS CDK gives you real code and real abstractions — and real ways to make a mess. Here are the constructs, stack, and testing patterns that scale.Fri, 12 Jun 2026 00:00:00 GMTiaciacaws-cdkawstypescriptpythoncloudhttps://devopsaitoolkit.com/blog/azure-bicep-cleaner-arm-templates-for-azure-infrastructure/https://devopsaitoolkit.com/blog/azure-bicep-cleaner-arm-templates-for-azure-infrastructure/Bicep is Microsoft's domain-specific language that compiles to ARM JSON — with modules, type safety, and readable syntax. Here's how to use it well on Azure.Fri, 12 Jun 2026 00:00:00 GMTiaciacbicepazurearm-templatescloudmoduleshttps://devopsaitoolkit.com/blog/bash-arrays-and-associative-arrays-for-ops-scripts/https://devopsaitoolkit.com/blog/bash-arrays-and-associative-arrays-for-ops-scripts/Most flaky Bash scripts fall apart the moment they handle a list with a space in it. Indexed and associative arrays fix that — here's how to use them properly.Fri, 12 Jun 2026 00:00:00 GMTbash-python-automationbashpythonarraysshell-scriptingautomationdevopshttps://devopsaitoolkit.com/blog/blast-radius-mapping-knowing-what-breaks-before-it-does/https://devopsaitoolkit.com/blog/blast-radius-mapping-knowing-what-breaks-before-it-does/During an outage the killer question is 'what else does this take down?' Here's how to map dependencies and blast radius so you answer it in seconds, not hours.Fri, 12 Jun 2026 00:00:00 GMTincident-responseincident-responsedependenciessrearchitectureobservabilityresiliencehttps://devopsaitoolkit.com/blog/building-a-slack-status-bot-real-time-service-health-where-your-team-lives/https://devopsaitoolkit.com/blog/building-a-slack-status-bot-real-time-service-health-where-your-team-lives/Nobody checks the status dashboard until something's broken. A Slack status bot brings live service health to where your team already is. Here's how to build one that earns trust.Fri, 12 Jun 2026 00:00:00 GMTslackslackstatus-bothealth-checksobservabilitychatopsdevopshttps://devopsaitoolkit.com/blog/building-an-incident-war-room-that-works-tooling-and-roles/https://devopsaitoolkit.com/blog/building-an-incident-war-room-that-works-tooling-and-roles/A chaotic incident channel makes outages longer. Here's how to set up a war room — the tooling, the roles, the channel discipline — that actually speeds recovery.Fri, 12 Jun 2026 00:00:00 GMTincident-responseincident-responsetoolingcollaborationsrechatopswar-roomhttps://devopsaitoolkit.com/blog/building-slack-socket-mode-apps-for-ops-no-public-endpoint/https://devopsaitoolkit.com/blog/building-slack-socket-mode-apps-for-ops-no-public-endpoint/Socket Mode lets your Slack ops bot run behind the firewall with no inbound port and no public URL. Here's how to build one that survives reconnects and production.Fri, 12 Jun 2026 00:00:00 GMTslackslacksocket-modeboltchatopsdevopspythonhttps://devopsaitoolkit.com/blog/building-teams-message-extensions-for-devops-self-service/https://devopsaitoolkit.com/blog/building-teams-message-extensions-for-devops-self-service/Message extensions let engineers query deploys, search runbooks, and file tickets without leaving the Teams compose box. Here's how to build ones people use.Fri, 12 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsmessage-extensionschatopsself-servicebot-frameworkdevopshttps://devopsaitoolkit.com/blog/certificate-lifecycle-and-internal-pki-management/https://devopsaitoolkit.com/blog/certificate-lifecycle-and-internal-pki-management/Expired certs cause more outages than most attacks. Here's how to automate the full certificate lifecycle and run an internal PKI that issues, rotates, and revokes without manual toil.Fri, 12 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningpkicertificatestlsautomationhttps://devopsaitoolkit.com/blog/closing-the-loop-making-incident-action-items-actually-get-done/https://devopsaitoolkit.com/blog/closing-the-loop-making-incident-action-items-actually-get-done/Most postmortem action items die in a backlog and the same incident happens again. Here's how to track follow-through so your learnings actually stick.Fri, 12 Jun 2026 00:00:00 GMTincident-responseincident-responsepostmortemaction-itemssrereliabilityprocesshttps://devopsaitoolkit.com/blog/cloud-init-recipes-for-bootstrapping-servers-the-right-way/https://devopsaitoolkit.com/blog/cloud-init-recipes-for-bootstrapping-servers-the-right-way/Cloud-init runs on first boot across every major cloud. Get it right and your instances are configured before you ever SSH in. Here are the patterns that hold up.Fri, 12 Jun 2026 00:00:00 GMTiaciaccloud-initprovisioningawsautomationbootstraphttps://devopsaitoolkit.com/blog/cluster-autoscaling-with-karpenter-and-cluster-autoscaler/https://devopsaitoolkit.com/blog/cluster-autoscaling-with-karpenter-and-cluster-autoscaler/Pods stuck Pending or a cloud bill that won't quit usually mean your node autoscaling is wrong. Here's how Cluster Autoscaler and Karpenter differ and when to use each.Fri, 12 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesautoscalingkarpentercluster-autoscalercost-optimizationnodeshttps://devopsaitoolkit.com/blog/compliance-as-code-soc2-cis-evidence-automation/https://devopsaitoolkit.com/blog/compliance-as-code-soc2-cis-evidence-automation/Audit season shouldn't mean a month of screenshots. Here's how to express controls as code and generate continuous, queryable compliance evidence for SOC 2 and CIS automatically.Fri, 12 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningcompliancesoc2cispolicy-as-codehttps://devopsaitoolkit.com/blog/crossplane-compositions-building-your-own-cloud-api/https://devopsaitoolkit.com/blog/crossplane-compositions-building-your-own-cloud-api/Crossplane turns Kubernetes into a control plane for any cloud. Compositions let you offer self-service infra to devs. Here's how the pieces fit together.Fri, 12 Jun 2026 00:00:00 GMTiaciaccrossplanekubernetesplatform-engineeringcloudself-servicehttps://devopsaitoolkit.com/blog/customer-communication-during-outages-what-to-say-and-when/https://devopsaitoolkit.com/blog/customer-communication-during-outages-what-to-say-and-when/How you talk to customers during an outage shapes whether they trust you after. Here's a practical framework for honest, well-timed outage communication.Fri, 12 Jun 2026 00:00:00 GMTincident-responseincident-responsecommunicationcustomer-successsretruston-callhttps://devopsaitoolkit.com/blog/cutting-alert-noise-designing-alerts-engineers-actually-trust/https://devopsaitoolkit.com/blog/cutting-alert-noise-designing-alerts-engineers-actually-trust/Most on-call pain isn't real incidents — it's noisy alerts that page at 3am for nothing. Here's how to design alerts on symptoms, not causes, and earn back trust.Fri, 12 Jun 2026 00:00:00 GMTincident-responseincident-responsealertingon-callobservabilitysremonitoringhttps://devopsaitoolkit.com/blog/cutting-cloud-bills-with-infracost-in-your-terraform-pipeline/https://devopsaitoolkit.com/blog/cutting-cloud-bills-with-infracost-in-your-terraform-pipeline/Most cloud overspend is committed in a Terraform PR nobody priced. Here's how to put a dollar figure on every plan with Infracost and catch the expensive change before merge.Fri, 12 Jun 2026 00:00:00 GMTterraformterraforminfracostfinopscostcicloudhttps://devopsaitoolkit.com/blog/debugging-heat-orchestration-stacks-openstack/https://devopsaitoolkit.com/blog/debugging-heat-orchestration-stacks-openstack/Stacks stuck in CREATE_FAILED, rollback loops, and dependency hell. Here's how to debug OpenStack Heat templates and recover wedged stacks in production.Fri, 12 Jun 2026 00:00:00 GMTopenstackopenstackheatorchestrationiachot-templatesautomationhttps://devopsaitoolkit.com/blog/debugging-ironic-bare-metal-provisioning-openstack/https://devopsaitoolkit.com/blog/debugging-ironic-bare-metal-provisioning-openstack/Nodes stuck in cleaning, PXE that won't boot, and IPMI that lies. Here's how to debug OpenStack Ironic bare metal provisioning in production.Fri, 12 Jun 2026 00:00:00 GMTopenstackopenstackironicbare-metalpxeipmiprovisioninghttps://devopsaitoolkit.com/blog/distributed-tracing-with-grafana-tempo-and-prometheus/https://devopsaitoolkit.com/blog/distributed-tracing-with-grafana-tempo-and-prometheus/Metrics tell you something is slow; traces tell you where. Here's how to run Grafana Tempo next to Prometheus and use exemplars to jump from a latency spike to the exact trace.Fri, 12 Jun 2026 00:00:00 GMTprometheus-monitoringprometheustempotracinggrafanaobservabilitysrehttps://devopsaitoolkit.com/blog/distributing-internal-slack-apps-with-manifests-and-app-config/https://devopsaitoolkit.com/blog/distributing-internal-slack-apps-with-manifests-and-app-config/Click-ops Slack app config doesn't survive audits or new workspaces. Here's how app manifests let you version, review, and deploy your ops bots like real software.Fri, 12 Jun 2026 00:00:00 GMTslackslackapp-manifestdistributioniacdevopschatopshttps://devopsaitoolkit.com/blog/ebpf-security-observability-for-devops/https://devopsaitoolkit.com/blog/ebpf-security-observability-for-devops/eBPF turns the kernel into a programmable security sensor with near-zero overhead. Here's how to use it for deep visibility into process, network, and file activity without agents.Fri, 12 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningebpfobservabilitykernelmonitoringhttps://devopsaitoolkit.com/blog/encrypting-linux-disks-with-luks-without-losing-your-data/https://devopsaitoolkit.com/blog/encrypting-linux-disks-with-luks-without-losing-your-data/Disk encryption is non-negotiable for anything that leaves the data center. Here's how I set up and manage LUKS without bricking the volume or losing the only key.Fri, 12 Jun 2026 00:00:00 GMTlinux-adminslinuxluksencryptionsecuritycryptsetupstoragehttps://devopsaitoolkit.com/blog/etcd-backup-and-restore-for-kubernetes-clusters/https://devopsaitoolkit.com/blog/etcd-backup-and-restore-for-kubernetes-clusters/If you self-manage a control plane, etcd is the one thing that can lose your whole cluster. Here's how to back it up, test restores, and recover under pressure.Fri, 12 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesetcdbackupdisaster-recoverycontrol-planeoperationshttps://devopsaitoolkit.com/blog/file-locking-and-signal-handling-for-safe-scripts/https://devopsaitoolkit.com/blog/file-locking-and-signal-handling-for-safe-scripts/A cron job that overlaps itself or dies mid-write causes outages. flock and signal handling are the cheap fixes — here's how to do both in Bash and Python.Fri, 12 Jun 2026 00:00:00 GMTbash-python-automationbashpythonflocksignalsconcurrencyautomationhttps://devopsaitoolkit.com/blog/gitlab-ci-caching-strategies-deep-dive/https://devopsaitoolkit.com/blog/gitlab-ci-caching-strategies-deep-dive/Cache keys, policies, fallback keys and the artifacts-vs-cache distinction — a practical deep dive into GitLab CI caching that turns slow pipelines fast.Fri, 12 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdcachingperformancepipeline-optimizationrunnershttps://devopsaitoolkit.com/blog/gitlab-ci-helm-deployments-without-auto-devops-magic/https://devopsaitoolkit.com/blog/gitlab-ci-helm-deployments-without-auto-devops-magic/Deploy to Kubernetes from GitLab CI with Helm — linting, templating, gated upgrades and rollbacks — keeping the control Auto DevOps hides from you.Fri, 12 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdhelmkubernetesdeploymentauto-devopshttps://devopsaitoolkit.com/blog/gitlab-ci-pipeline-cost-optimization/https://devopsaitoolkit.com/blog/gitlab-ci-pipeline-cost-optimization/CI minutes, storage and runner spend add up fast. Here's how to find where GitLab CI money goes and cut it with rules, caching, interruptible jobs and right-sized runners.Fri, 12 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdcost-optimizationci-minutesrunnersfinopshttps://devopsaitoolkit.com/blog/gitlab-ci-terraform-iac-pipeline/https://devopsaitoolkit.com/blog/gitlab-ci-terraform-iac-pipeline/Run Terraform from GitLab CI with the managed state backend, plan-on-MR, gated apply, and locking — so infra changes get reviewed like code instead of YOLO'd from a laptop.Fri, 12 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdterraformiacinfrastructuregitopshttps://devopsaitoolkit.com/blog/gitlab-container-scanning-sast-dast-shift-security-left/https://devopsaitoolkit.com/blog/gitlab-container-scanning-sast-dast-shift-security-left/How to wire container scanning, SAST and DAST into GitLab CI so vulnerabilities surface in the merge request instead of in production — without tanking pipeline speed.Fri, 12 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdsecuritysastdastcontainer-scanningdevsecopshttps://devopsaitoolkit.com/blog/gitlab-dependency-scanning-sbom-supply-chain-security/https://devopsaitoolkit.com/blog/gitlab-dependency-scanning-sbom-supply-chain-security/Wire dependency scanning and SBOM generation into GitLab CI so you can answer 'are we affected?' in minutes the next time a popular package is compromised.Fri, 12 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicddependency-scanningsbomsupply-chainsecurityhttps://devopsaitoolkit.com/blog/gitlab-dynamic-environments-ephemeral-stop-jobs/https://devopsaitoolkit.com/blog/gitlab-dynamic-environments-ephemeral-stop-jobs/Use GitLab dynamic environments with on_stop jobs and auto-stop timers to provision per-branch infrastructure that cleans itself up — no more orphaned namespaces.Fri, 12 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdenvironmentsephemeralkubernetescleanuphttps://devopsaitoolkit.com/blog/gitlab-pages-static-sites-ci-deploy/https://devopsaitoolkit.com/blog/gitlab-pages-static-sites-ci-deploy/Use GitLab Pages and CI to publish documentation, coverage reports and static sites — with per-MR previews, custom domains and HTTPS — straight from your pipeline.Fri, 12 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdgitlab-pagesstatic-sitesdocumentationssghttps://devopsaitoolkit.com/blog/gitops-for-terraform-with-atlantis-and-spacelift/https://devopsaitoolkit.com/blog/gitops-for-terraform-with-atlantis-and-spacelift/Running terraform apply from laptops doesn't scale or stay safe. Here's how Atlantis and Spacelift turn pull requests into the apply workflow — and how to pick between them.Fri, 12 Jun 2026 00:00:00 GMTterraformterraformgitopsatlantisspaceliftciautomationhttps://devopsaitoolkit.com/blog/handling-slo-and-sla-breaches-error-budgets-to-customer-credits/https://devopsaitoolkit.com/blog/handling-slo-and-sla-breaches-error-budgets-to-customer-credits/An SLO breach is an engineering signal; an SLA breach is a contractual one. Here's how to handle both without panic, and how AI helps assess and communicate them.Fri, 12 Jun 2026 00:00:00 GMTincident-responseincident-responsesloslaerror-budgetsrereliabilityhttps://devopsaitoolkit.com/blog/hardening-the-docker-daemon-and-container-runtime/https://devopsaitoolkit.com/blog/hardening-the-docker-daemon-and-container-runtime/A container escape becomes a host takeover when the daemon is wide open. Here's how to harden the Docker daemon, runtime, and container defaults so a breakout goes nowhere.Fri, 12 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningdockercontainer-runtimelinuxseccomphttps://devopsaitoolkit.com/blog/importing-existing-infrastructure-into-terraform-at-scale/https://devopsaitoolkit.com/blog/importing-existing-infrastructure-into-terraform-at-scale/Bringing a pile of click-ops resources under Terraform without an outage is a real project. Here's a staged approach using import blocks, generated config, and zero-change plans.Fri, 12 Jun 2026 00:00:00 GMTterraformterraformimportbrownfieldmigrationiacstatehttps://devopsaitoolkit.com/blog/instrumenting-services-with-the-opentelemetry-collector/https://devopsaitoolkit.com/blog/instrumenting-services-with-the-opentelemetry-collector/The OpenTelemetry Collector is the most useful box in a modern monitoring stack — and the easiest to misconfigure. Here's how to wire it into Prometheus without losing data or your mind.Fri, 12 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusopentelemetryotel-collectorobservabilitymetricssrehttps://devopsaitoolkit.com/blog/jq-for-json-in-bash-automation/https://devopsaitoolkit.com/blog/jq-for-json-in-bash-automation/Every modern CLI and API speaks JSON, and grep can't parse it. jq is the missing tool — here's the practical subset that handles real DevOps work.Fri, 12 Jun 2026 00:00:00 GMTbash-python-automationbashpythonjqjsonapiautomationhttps://devopsaitoolkit.com/blog/keeping-linux-clocks-in-sync-with-chrony-and-ntp/https://devopsaitoolkit.com/blog/keeping-linux-clocks-in-sync-with-chrony-and-ntp/Clock drift causes weird, expensive bugs that look like everything except a time problem. Here's how I keep Linux servers in sync with chrony.Fri, 12 Jun 2026 00:00:00 GMTlinux-adminslinuxchronyntptime-synctroubleshootingnetworkinghttps://devopsaitoolkit.com/blog/keeping-terraform-dry-with-terragrunt-without-the-magic/https://devopsaitoolkit.com/blog/keeping-terraform-dry-with-terragrunt-without-the-magic/Terragrunt promises DRY Terraform across dozens of environments, but it's easy to bury your config in indirection. Here's how to adopt it deliberately and keep it debuggable.Fri, 12 Jun 2026 00:00:00 GMTterraformterraformterragruntdryenvironmentsiacbackendshttps://devopsaitoolkit.com/blog/kube-state-metrics-vs-node-exporter-monitoring-kubernetes/https://devopsaitoolkit.com/blog/kube-state-metrics-vs-node-exporter-monitoring-kubernetes/These two exporters answer completely different questions, and conflating them is why Kubernetes dashboards lie. Here's what each one knows and the PromQL that puts them together.Fri, 12 Jun 2026 00:00:00 GMTprometheus-monitoringprometheuskube-state-metricskubernetesnode-exporterpromqlsrehttps://devopsaitoolkit.com/blog/kubernetes-jobs-and-cronjobs-patterns-that-hold-up/https://devopsaitoolkit.com/blog/kubernetes-jobs-and-cronjobs-patterns-that-hold-up/Batch work on Kubernetes looks trivial until a CronJob fires twice, piles up, or never cleans up. Here are the Job and CronJob patterns that survive production.Fri, 12 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesjobscronjobbatchschedulingreliabilityhttps://devopsaitoolkit.com/blog/kyverno-policy-as-code-for-kubernetes-without-rego/https://devopsaitoolkit.com/blog/kyverno-policy-as-code-for-kubernetes-without-rego/Kyverno writes Kubernetes admission policies in plain YAML — no new query language. Here's how to validate, mutate, and generate resources to keep clusters sane.Fri, 12 Jun 2026 00:00:00 GMTiaciackyvernokubernetespolicy-as-codesecuritygovernancehttps://devopsaitoolkit.com/blog/linux-auditd-tracking-who-did-what-on-your-servers/https://devopsaitoolkit.com/blog/linux-auditd-tracking-who-did-what-on-your-servers/When something changes on a server and nobody owns up, auditd has the answer. Here's how I configure the Linux audit subsystem without drowning in noise.Fri, 12 Jun 2026 00:00:00 GMTlinux-adminslinuxauditdsecuritycomplianceloggingforensicshttps://devopsaitoolkit.com/blog/managing-ansible-vault-secrets-without-losing-your-mind/https://devopsaitoolkit.com/blog/managing-ansible-vault-secrets-without-losing-your-mind/Ansible Vault is the simplest way to keep secrets in your repo without leaking them — if you set it up right. Here's a battle-tested workflow for teams.Fri, 12 Jun 2026 00:00:00 GMTansibleiacansibleansible-vaultsecretssecurityaihttps://devopsaitoolkit.com/blog/managing-designate-dns-as-a-service-openstack/https://devopsaitoolkit.com/blog/managing-designate-dns-as-a-service-openstack/Zones stuck in PENDING, pool manager confusion, and records that never propagate. Here's how to run OpenStack Designate DNS in production.Fri, 12 Jun 2026 00:00:00 GMTopenstackopenstackdesignatednsdnsaasbindnetworkinghttps://devopsaitoolkit.com/blog/managing-kubernetes-config-with-kustomize-overlays/https://devopsaitoolkit.com/blog/managing-kubernetes-config-with-kustomize-overlays/Copy-pasting manifests per environment is how config drift starts. Here's how I structure Kustomize bases and overlays to keep environments honest.Fri, 12 Jun 2026 00:00:00 GMTkubernetes-helmkuberneteskustomizegitopsconfigurationoverlaysyamlhttps://devopsaitoolkit.com/blog/managing-multiple-kubernetes-clusters-without-losing-track/https://devopsaitoolkit.com/blog/managing-multiple-kubernetes-clusters-without-losing-track/Once you're running more than one cluster, the risk isn't scale — it's applying the right change to the wrong cluster. Here's how I keep multi-cluster ops safe.Fri, 12 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesmulti-clusterkubeconfigfleetgitopsoperationshttps://devopsaitoolkit.com/blog/managing-quotas-and-capacity-planning-openstack/https://devopsaitoolkit.com/blog/managing-quotas-and-capacity-planning-openstack/'No valid host was found', quota drift, and the overcommit math nobody checks. Here's how to manage OpenStack quotas and plan capacity before you run out.Fri, 12 Jun 2026 00:00:00 GMTopenstackopenstackquotascapacity-planningplacementschedulingnovahttps://devopsaitoolkit.com/blog/migrating-from-iptables-to-nftables-a-practical-firewall-guide/https://devopsaitoolkit.com/blog/migrating-from-iptables-to-nftables-a-practical-firewall-guide/iptables is on its way out and nftables is the replacement. Here's how I migrate real firewalls without locking myself out or dropping traffic.Fri, 12 Jun 2026 00:00:00 GMTlinux-adminslinuxnftablesiptablesfirewallnetworkingsecurityhttps://devopsaitoolkit.com/blog/migrating-neutron-to-ovn-openstack/https://devopsaitoolkit.com/blog/migrating-neutron-to-ovn-openstack/Why OVN replaces the agent sprawl, how the migration actually works, and how to debug the OVN southbound DB when networking breaks in OpenStack.Fri, 12 Jun 2026 00:00:00 GMTopenstackopenstackovnneutronnetworkingsdnovshttps://devopsaitoolkit.com/blog/monitoring-the-slack-audit-logs-api-for-security-and-compliance/https://devopsaitoolkit.com/blog/monitoring-the-slack-audit-logs-api-for-security-and-compliance/Slack is a juicy target and a compliance scope you probably ignore. Here's how to stream the Audit Logs API into your SIEM and alert on the events that actually matter.Fri, 12 Jun 2026 00:00:00 GMTslackslackaudit-logssecuritycompliancesiemdevopshttps://devopsaitoolkit.com/blog/mtls-and-service-identity-with-spiffe-spire/https://devopsaitoolkit.com/blog/mtls-and-service-identity-with-spiffe-spire/IP allowlists and shared API keys don't survive autoscaling. Here's how to give every workload a cryptographic identity with SPIFFE/SPIRE and enforce mTLS that actually means something.Fri, 12 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningmtlsspiffezero-trustservice-meshhttps://devopsaitoolkit.com/blog/node-exporter-deep-dive-the-metrics-that-matter/https://devopsaitoolkit.com/blog/node-exporter-deep-dive-the-metrics-that-matter/node_exporter spits out thousands of series, but you reach for maybe twenty. Here are the host metrics I trust, the PromQL to compute them, and the collectors to turn off.Fri, 12 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusnode-exporterlinuxmetricspromqlsrehttps://devopsaitoolkit.com/blog/observability-for-incidents-the-signals-you-need-before-3am/https://devopsaitoolkit.com/blog/observability-for-incidents-the-signals-you-need-before-3am/Dashboards built for demos are useless during an outage. Here's how to instrument for the questions you'll actually ask at 3am, not the ones that look good.Fri, 12 Jun 2026 00:00:00 GMTincident-responseincident-responseobservabilitymetricstracingloggingsrehttps://devopsaitoolkit.com/blog/onboarding-new-engineers-to-on-call-without-throwing-them-to-the-wolves/https://devopsaitoolkit.com/blog/onboarding-new-engineers-to-on-call-without-throwing-them-to-the-wolves/Putting a new engineer on the pager cold is how you create panic and turnover. Here's a structured on-call onboarding path that builds real confidence.Fri, 12 Jun 2026 00:00:00 GMTincident-responseincident-responseon-callonboardingsreteam-healthmentorshiphttps://devopsaitoolkit.com/blog/packaging-python-ops-tools-with-uv/https://devopsaitoolkit.com/blog/packaging-python-ops-tools-with-uv/The handoff from a single script to a shareable tool is where most ops Python rots. uv handles environments, dependencies, and distribution fast — here's how.Fri, 12 Jun 2026 00:00:00 GMTbash-python-automationpythonbashuvpackagingdependenciesautomationhttps://devopsaitoolkit.com/blog/parallel-execution-with-xargs-and-gnu-parallel/https://devopsaitoolkit.com/blog/parallel-execution-with-xargs-and-gnu-parallel/Running ops tasks one at a time wastes hours. xargs -P and GNU parallel fan them out — here's how to do it safely with concurrency limits and clean output.Fri, 12 Jun 2026 00:00:00 GMTbash-python-automationbashpythonxargsgnu-parallelconcurrencyautomationhttps://devopsaitoolkit.com/blog/policy-as-code-for-terraform-with-opa-and-sentinel/https://devopsaitoolkit.com/blog/policy-as-code-for-terraform-with-opa-and-sentinel/Stop relying on PR reviewers to catch the public S3 bucket. Here's how to enforce Terraform guardrails automatically with OPA/Conftest and Sentinel — and which checks are worth writing.Fri, 12 Jun 2026 00:00:00 GMTterraformterraformpolicy-as-codeopasentinelsecuritycihttps://devopsaitoolkit.com/blog/proactive-messaging-from-teams-bots-without-getting-rate-limited/https://devopsaitoolkit.com/blog/proactive-messaging-from-teams-bots-without-getting-rate-limited/Proactive messages let your bot ping engineers first. Here's how to store conversation references, fan out safely, and survive Teams throttling at scale.Fri, 12 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsproactive-messagingbot-frameworkrate-limitingchatopsdevopshttps://devopsaitoolkit.com/blog/prometheus-high-availability-and-federation-done-right/https://devopsaitoolkit.com/blog/prometheus-high-availability-and-federation-done-right/Running two Prometheus replicas and federating across clusters sounds simple until the graphs flicker and the cardinality explodes. Here's the architecture that actually holds up.Fri, 12 Jun 2026 00:00:00 GMTprometheus-monitoringprometheushigh-availabilityfederationscalingthanossrehttps://devopsaitoolkit.com/blog/prometheus-pushgateway-when-to-use-it-and-when-not-to/https://devopsaitoolkit.com/blog/prometheus-pushgateway-when-to-use-it-and-when-not-to/The Pushgateway is the most misused component in the Prometheus ecosystem. Here's the narrow set of jobs it's actually for, the traps it sets, and what to use instead.Fri, 12 Jun 2026 00:00:00 GMTprometheus-monitoringprometheuspushgatewaybatch-jobsmetricspromqlsrehttps://devopsaitoolkit.com/blog/pulumi-infrastructure-as-real-code-python-go-typescript/https://devopsaitoolkit.com/blog/pulumi-infrastructure-as-real-code-python-go-typescript/Pulumi lets you provision cloud infra in a language you already know — with loops, functions, and tests. Here's how it differs from HCL and where it shines.Fri, 12 Jun 2026 00:00:00 GMTiaciacpulumipythongolangtypescriptcloudhttps://devopsaitoolkit.com/blog/python-asyncio-for-ops-concurrent-io/https://devopsaitoolkit.com/blog/python-asyncio-for-ops-concurrent-io/When your script spends all its time waiting on the network, asyncio turns a 10-minute job into a 5-second one. A practical asyncio guide for DevOps work.Fri, 12 Jun 2026 00:00:00 GMTbash-python-automationpythonbashasyncioconcurrencyhttpautomationhttps://devopsaitoolkit.com/blog/python-config-management-pydantic-and-env-vars/https://devopsaitoolkit.com/blog/python-config-management-pydantic-and-env-vars/Scattered os.environ calls and silent type bugs make ops scripts fragile. Pydantic Settings gives you typed, validated, fail-fast config — here's the pattern.Fri, 12 Jun 2026 00:00:00 GMTbash-python-automationpythonbashpydanticconfigurationtwelve-factorautomationhttps://devopsaitoolkit.com/blog/reducing-alert-fatigue-with-the-use-and-red-methods/https://devopsaitoolkit.com/blog/reducing-alert-fatigue-with-the-use-and-red-methods/Most alert fatigue comes from alerting on causes instead of symptoms. The USE and RED methods give you a small, durable set of signals worth a human's sleep. Here's how to apply them in Prometheus.Fri, 12 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusalert-fatigueuse-methodred-methodslosrehttps://devopsaitoolkit.com/blog/routing-azure-monitor-alerts-to-teams-the-right-way/https://devopsaitoolkit.com/blog/routing-azure-monitor-alerts-to-teams-the-right-way/Azure Monitor's raw alert payloads are noisy and hard to read in Teams. Here's how to shape them into adaptive cards engineers can act on, not ignore.Fri, 12 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsazure-monitoralertsadaptive-cardsaction-groupsobservabilityhttps://devopsaitoolkit.com/blog/running-kubernetes-on-openstack-with-magnum/https://devopsaitoolkit.com/blog/running-kubernetes-on-openstack-with-magnum/Cluster templates, stuck CREATE_IN_PROGRESS, and the Cloud Provider OpenStack glue. Here's how to run Magnum-managed Kubernetes in production.Fri, 12 Jun 2026 00:00:00 GMTopenstackopenstackmagnumkubernetescontainersheatcloud-providerhttps://devopsaitoolkit.com/blog/running-statefulsets-in-production-without-surprises/https://devopsaitoolkit.com/blog/running-statefulsets-in-production-without-surprises/StatefulSets look like Deployments with stable names, but the operational rules are different. Here's what bites teams running databases on Kubernetes.Fri, 12 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesstatefulsetdatabasesstateful-workloadsoperationsscalinghttps://devopsaitoolkit.com/blog/runtime-threat-detection-with-falco/https://devopsaitoolkit.com/blog/runtime-threat-detection-with-falco/Scanning catches bad images before they run. Falco catches bad behavior while they run. Here's how to deploy runtime detection that flags the breach in real time without alert fatigue.Fri, 12 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningfalcoruntimedetectionkuberneteshttps://devopsaitoolkit.com/blog/scaling-octavia-load-balancers-openstack/https://devopsaitoolkit.com/blog/scaling-octavia-load-balancers-openstack/Amphorae that won't boot, stuck PENDING_CREATE load balancers, and failover storms. Here's how to run Octavia LBaaS in production without losing sleep.Fri, 12 Jun 2026 00:00:00 GMTopenstackopenstackoctaviaload-balancinglbaasamphoranetworkinghttps://devopsaitoolkit.com/blog/securing-secrets-with-barbican-openstack/https://devopsaitoolkit.com/blog/securing-secrets-with-barbican-openstack/TLS certs, LUKS keys, and the HSM plugin. Here's how to run OpenStack Barbican key management safely and debug it when secrets won't decrypt.Fri, 12 Jun 2026 00:00:00 GMTopenstackopenstackbarbicansecretskmsencryptionsecurityhttps://devopsaitoolkit.com/blog/sed-and-awk-mastery-for-devops-text-processing/https://devopsaitoolkit.com/blog/sed-and-awk-mastery-for-devops-text-processing/Most DevOps text munging doesn't need a script — it needs one well-aimed sed or awk command. Here's the practical subset that covers nearly everything.Fri, 12 Jun 2026 00:00:00 GMTbash-python-automationbashpythonsedawktext-processingautomationhttps://devopsaitoolkit.com/blog/service-mesh-basics-with-istio-and-linkerd/https://devopsaitoolkit.com/blog/service-mesh-basics-with-istio-and-linkerd/A service mesh gives you mTLS, retries, and traffic shifting without touching app code — but it's not free. Here's what a mesh does and when it's worth the weight.Fri, 12 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesservice-meshistiolinkerdmtlsobservabilityhttps://devopsaitoolkit.com/blog/slack-canvas-for-living-runbooks-keep-ops-docs-where-the-work-happens/https://devopsaitoolkit.com/blog/slack-canvas-for-living-runbooks-keep-ops-docs-where-the-work-happens/Runbooks rot in wikis nobody opens during an incident. Slack canvas puts them in the channel, editable in the moment. Here's how to use canvas for ops that actually gets used.Fri, 12 Jun 2026 00:00:00 GMTslackslackcanvasrunbooksdocumentationincident-responsedevopshttps://devopsaitoolkit.com/blog/sso-for-teams-apps-on-behalf-of-flow-without-the-pain/https://devopsaitoolkit.com/blog/sso-for-teams-apps-on-behalf-of-flow-without-the-pain/Teams SSO lets your tab or bot get a token silently and call Graph or your own APIs as the user. Here's the on-behalf-of flow, set up so it actually works.Fri, 12 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsssoazure-adon-behalf-ofgraph-apisecurityhttps://devopsaitoolkit.com/blog/summarizing-slack-threads-with-ai-turn-200-message-incidents-into-3-bullets/https://devopsaitoolkit.com/blog/summarizing-slack-threads-with-ai-turn-200-message-incidents-into-3-bullets/Nobody reads a 200-message incident thread to catch up. Here's how to build an AI thread summarizer that gives joiners and stakeholders the state in seconds.Fri, 12 Jun 2026 00:00:00 GMTslackslackaisummarizationincident-responsechatopsllmhttps://devopsaitoolkit.com/blog/surviving-slack-api-rate-limits-retries-backoff-and-batching-for-bots/https://devopsaitoolkit.com/blog/surviving-slack-api-rate-limits-retries-backoff-and-batching-for-bots/Your Slack bot works until the incident that floods it. Here's how to handle rate limits, Retry-After, and bursty traffic so it stays up when you need it most.Fri, 12 Jun 2026 00:00:00 GMTslackslackrate-limitsapireliabilitychatopsdevopshttps://devopsaitoolkit.com/blog/taming-terraform-dynamic-blocks-without-making-config-unreadable/https://devopsaitoolkit.com/blog/taming-terraform-dynamic-blocks-without-making-config-unreadable/Dynamic blocks kill repetition in Terraform, but they're also where readable config goes to die. Here's how to use them deliberately — and when a plain static block is the better call.Fri, 12 Jun 2026 00:00:00 GMTterraformterraformdynamic-blockshcliacmodulesaihttps://devopsaitoolkit.com/blog/teams-deep-links-that-take-engineers-straight-to-the-problem/https://devopsaitoolkit.com/blog/teams-deep-links-that-take-engineers-straight-to-the-problem/A deep link can drop an on-call engineer into the exact channel, message, or app tab they need. Here's how to build them so your alerts are one tap from action.Fri, 12 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsdeep-linkschatopson-callnavigationdevopshttps://devopsaitoolkit.com/blog/teams-tabs-and-personal-apps-for-devops-dashboards/https://devopsaitoolkit.com/blog/teams-tabs-and-personal-apps-for-devops-dashboards/Stop making engineers tab out to Grafana. Embed your dashboards, runbooks, and on-call view as Teams tabs and personal apps that load in context.Fri, 12 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamstabspersonal-appsdashboardsteams-jsdevopshttps://devopsaitoolkit.com/blog/terraform-provider-configuration-and-aliases-done-right/https://devopsaitoolkit.com/blog/terraform-provider-configuration-and-aliases-done-right/Multi-region and multi-account Terraform lives and dies on provider aliases. Here's how to configure providers, pass them into modules, and avoid the errors that block every apply.Fri, 12 Jun 2026 00:00:00 GMTterraformterraformprovidersaliasesmulti-regionmodulesawshttps://devopsaitoolkit.com/blog/terraform-workspaces-vs-directories-when-each-one-makes-sense/https://devopsaitoolkit.com/blog/terraform-workspaces-vs-directories-when-each-one-makes-sense/Workspaces look like the obvious way to manage dev, staging, and prod — until they aren't. Here's how to choose between workspaces and directory-per-environment without painting yourself into a corner.Fri, 12 Jun 2026 00:00:00 GMTterraformterraformworkspacesenvironmentsstateiacaihttps://devopsaitoolkit.com/blog/testing-helm-charts-before-they-reach-production/https://devopsaitoolkit.com/blog/testing-helm-charts-before-they-reach-production/A Helm chart that templates cleanly can still ship a broken release. Here's the testing layers I use — lint, template, schema, and helm test — to catch it first.Fri, 12 Jun 2026 00:00:00 GMTkubernetes-helmkuberneteshelmtestingci-cdrelease-engineeringyamlhttps://devopsaitoolkit.com/blog/tracing-linux-with-bpftrace-and-ebpf-a-practical-guide/https://devopsaitoolkit.com/blog/tracing-linux-with-bpftrace-and-ebpf-a-practical-guide/When strace is too slow and metrics are too coarse, eBPF lets you ask the kernel exactly what you want. Here's how I use bpftrace to find the answer fast.Fri, 12 Jun 2026 00:00:00 GMTlinux-adminslinuxebpfbpftracetracingperformanceobservabilityhttps://devopsaitoolkit.com/blog/troubleshooting-linux-boot-failures-grub-and-initramfs/https://devopsaitoolkit.com/blog/troubleshooting-linux-boot-failures-grub-and-initramfs/A server that won't boot is the scariest kind of outage. Here's how I work through GRUB, initramfs, and emergency shells methodically instead of in a panic.Fri, 12 Jun 2026 00:00:00 GMTlinux-adminslinuxgrubinitramfsboottroubleshootingrecoveryhttps://devopsaitoolkit.com/blog/tuning-linux-swap-and-zram-for-better-memory-performance/https://devopsaitoolkit.com/blog/tuning-linux-swap-and-zram-for-better-memory-performance/Swap isn't evil and turning it off isn't a tuning strategy. Here's how I configure swap, swappiness, and zram so memory pressure degrades gracefully.Fri, 12 Jun 2026 00:00:00 GMTlinux-adminslinuxswapzrammemoryperformancetuninghttps://devopsaitoolkit.com/blog/tuning-prometheus-remote-write-for-reliable-shipping/https://devopsaitoolkit.com/blog/tuning-prometheus-remote-write-for-reliable-shipping/Remote write is how Prometheus feeds Thanos, Mimir, and Grafana Cloud — and the default queue settings will drop samples under load. Here's how to tune it so they don't.Fri, 12 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusremote-writethanosmimirscalingsrehttps://devopsaitoolkit.com/blog/waf-and-rate-limiting-protecting-your-edge/https://devopsaitoolkit.com/blog/waf-and-rate-limiting-protecting-your-edge/Your edge takes the first hit from every bot, scraper, and exploit scanner online. Here's how to layer a WAF and rate limiting that stops abuse without false-positiving your customers.Fri, 12 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningwafrate-limitingedgenginxhttps://devopsaitoolkit.com/blog/alertmanager-routing-without-losing-your-mind/https://devopsaitoolkit.com/blog/alertmanager-routing-without-losing-your-mind/Alertmanager's routing tree, grouping, and inhibition decide who gets paged and when. Here's how I configure it so the right person hears the right alert.Thu, 11 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusalertmanageralertingsreon-callmonitoringhttps://devopsaitoolkit.com/blog/analyzing-journald-logs-with-journalctl-and-ai/https://devopsaitoolkit.com/blog/analyzing-journald-logs-with-journalctl-and-ai/The journalctl filters that actually matter, how to scope logs to the moment things broke, and using AI to turn a wall of journal output into a root cause.Thu, 11 Jun 2026 00:00:00 GMTlinux-adminslinuxjournaldjournalctlloggingtroubleshootingsystemdhttps://devopsaitoolkit.com/blog/ansible-roles-and-inventory-structure-guide/https://devopsaitoolkit.com/blog/ansible-roles-and-inventory-structure-guide/A practical guide to organizing Ansible roles and inventory so your automation scales past one host group without turning into spaghetti.Thu, 11 Jun 2026 00:00:00 GMTansibleiacansiblerolesinventoryconfiguration-managementstructurehttps://devopsaitoolkit.com/blog/audit-logging-and-threat-detection-with-ai/https://devopsaitoolkit.com/blog/audit-logging-and-threat-detection-with-ai/Logs you can't query are just disk usage. Here's how I build audit logging that survives an incident — auditd, cloud trails, tamper-resistance — and use AI to surface real threats.Thu, 11 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningaudit-loggingdetectionsiemaihttps://devopsaitoolkit.com/blog/automating-incident-channels-in-slack/https://devopsaitoolkit.com/blog/automating-incident-channels-in-slack/Spin up a dedicated Slack incident channel automatically, seed it with context, manage roles, and capture the timeline for a clean postmortem.Thu, 11 Jun 2026 00:00:00 GMTslackslackincident-responsechatopsautomationsrepostmortemhttps://devopsaitoolkit.com/blog/automating-releases-with-gitlab-ci-semantic-versioning/https://devopsaitoolkit.com/blog/automating-releases-with-gitlab-ci-semantic-versioning/Manual releases are slow and error-prone. Here's how I automate versioning, changelogs, tags, and release notes in GitLab CI so shipping a release is a single merge.Thu, 11 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdreleasessemantic-versioningchangelogautomationhttps://devopsaitoolkit.com/blog/blackbox-and-synthetic-monitoring-with-prometheus/https://devopsaitoolkit.com/blog/blackbox-and-synthetic-monitoring-with-prometheus/Internal metrics tell you the server is fine while users get errors. Here's how I use the blackbox exporter to probe from the outside, like a user.Thu, 11 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusblackboxsynthetic-monitoringuptimesremonitoringhttps://devopsaitoolkit.com/blog/build-a-microsoft-teams-bot-with-bot-framework-for-chatops/https://devopsaitoolkit.com/blog/build-a-microsoft-teams-bot-with-bot-framework-for-chatops/A practical walkthrough for building a Teams bot with the Bot Framework SDK — handling commands, posting adaptive cards, and adding an AI assist layer safely.Thu, 11 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsbot-frameworkchatopsautomationnodejsazurehttps://devopsaitoolkit.com/blog/build-approval-workflows-in-microsoft-teams-with-adaptive-cards/https://devopsaitoolkit.com/blog/build-approval-workflows-in-microsoft-teams-with-adaptive-cards/Approve production deploys, access requests, and changes directly in Teams with adaptive cards and a real audit trail. Here's the pattern that scales.Thu, 11 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsapprovalsadaptive-cardsdevopsci-cdgovernancehttps://devopsaitoolkit.com/blog/build-declarative-copilot-agents-for-devops-in-microsoft-teams/https://devopsaitoolkit.com/blog/build-declarative-copilot-agents-for-devops-in-microsoft-teams/Declarative agents extend Microsoft 365 Copilot with your runbooks and tools. Here's how DevOps teams build one for Teams without writing a full bot.Thu, 11 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamscopilotdeclarative-agentsaichatopsautomationhttps://devopsaitoolkit.com/blog/building-a-slack-chatops-bot-for-devops-teams/https://devopsaitoolkit.com/blog/building-a-slack-chatops-bot-for-devops-teams/How to build a Slack ChatOps bot from scratch — scopes, event handling, command routing, and the safety rails that keep a bot from breaking production.Thu, 11 Jun 2026 00:00:00 GMTslackslackchatopsdevopsbotautomationslack-apihttps://devopsaitoolkit.com/blog/building-approval-workflows-in-slack/https://devopsaitoolkit.com/blog/building-approval-workflows-in-slack/How to build Slack approval workflows for production deploys and access requests — interactive buttons, authorization, audit trails, and timeouts.Thu, 11 Jun 2026 00:00:00 GMTslackslackapprovalschatopsdeploysaccess-controlcompliancehttps://devopsaitoolkit.com/blog/building-grafana-dashboards-people-actually-use/https://devopsaitoolkit.com/blog/building-grafana-dashboards-people-actually-use/Most dashboards are graph graveyards no one reads during an incident. Here's how I build Grafana dashboards that answer real questions fast.Thu, 11 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusgrafanadashboardsobservabilitysremonitoringhttps://devopsaitoolkit.com/blog/building-incident-runbooks-engineers-trust-at-3am/https://devopsaitoolkit.com/blog/building-incident-runbooks-engineers-trust-at-3am/Most runbooks rot or get ignored mid-incident. Here's how to write runbooks that hold up under pressure, keep them current, and use AI to draft and audit them.Thu, 11 Jun 2026 00:00:00 GMTincident-responseincident-responserunbookssreon-callautomationdocumentationhttps://devopsaitoolkit.com/blog/building-least-privilege-iam-policies-with-ai/https://devopsaitoolkit.com/blog/building-least-privilege-iam-policies-with-ai/Most IAM policies are wildly over-permissioned because tightening them is scary. Here's how I scope cloud permissions down safely — and use AI to draft and audit least-privilege policies.Thu, 11 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningiamawsleast-privilegeaihttps://devopsaitoolkit.com/blog/building-machine-images-with-packer-and-ai/https://devopsaitoolkit.com/blog/building-machine-images-with-packer-and-ai/Immutable infrastructure starts with a solid golden image. Here's how to build reproducible machine images with Packer, and where AI accelerates the work.Thu, 11 Jun 2026 00:00:00 GMTiaciacpackerimmutable-infrastructureimagesautomationaihttps://devopsaitoolkit.com/blog/building-python-cli-tools-with-typer-and-click/https://devopsaitoolkit.com/blog/building-python-cli-tools-with-typer-and-click/When a bash script outgrows its argument parsing, move it to Python. Here's how to build real CLI tools with Typer and Click, including subcommands and validation.Thu, 11 Jun 2026 00:00:00 GMTbash-python-automationpythonbashclicktypercliautomationhttps://devopsaitoolkit.com/blog/calling-apis-from-bash-and-python-scripts/https://devopsaitoolkit.com/blog/calling-apis-from-bash-and-python-scripts/curl and httpx make API calls easy and easy to get wrong. Here's how to handle auth, timeouts, errors, pagination, and rate limits in automation scripts.Thu, 11 Jun 2026 00:00:00 GMTbash-python-automationbashpythonapicurlhttpxautomationhttps://devopsaitoolkit.com/blog/cis-benchmark-hardening-linux-servers-with-ai/https://devopsaitoolkit.com/blog/cis-benchmark-hardening-linux-servers-with-ai/CIS Benchmarks are hundreds of controls deep. Here's how I apply the ones that matter to production Linux, automate the checks, and use AI to interpret findings without breaking servers.Thu, 11 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningcis-benchmarklinuxcomplianceaihttps://devopsaitoolkit.com/blog/container-image-scanning-with-trivy-and-ai-triage/https://devopsaitoolkit.com/blog/container-image-scanning-with-trivy-and-ai-triage/Image scanners produce hundreds of CVEs and almost no priorities. Here's how I scan with Trivy, fix what matters, and use AI to triage findings into a real action list.Thu, 11 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningcontainersvulnerability-scanningtrivyaihttps://devopsaitoolkit.com/blog/cron-vs-systemd-timers-scheduling-jobs-on-linux/https://devopsaitoolkit.com/blog/cron-vs-systemd-timers-scheduling-jobs-on-linux/When to use cron, when to use systemd timers, how to debug a job that never ran, and using AI to translate crontab syntax and write timer units.Thu, 11 Jun 2026 00:00:00 GMTlinux-adminslinuxcronsystemdtimersautomationschedulinghttps://devopsaitoolkit.com/blog/debugging-crashloopbackoff-and-pending-pods-with-ai/https://devopsaitoolkit.com/blog/debugging-crashloopbackoff-and-pending-pods-with-ai/CrashLoopBackOff and Pending are the two failure states every Kubernetes operator hits weekly. Here's a systematic way to debug both, with AI handling the tedious log reading.Thu, 11 Jun 2026 00:00:00 GMTkubernetes-helmkubernetestroubleshootingaipodsdebuggingsrehttps://devopsaitoolkit.com/blog/debugging-failing-gitlab-pipelines/https://devopsaitoolkit.com/blog/debugging-failing-gitlab-pipelines/Random retries are not a debugging strategy. Here's the systematic way I diagnose failing GitLab CI jobs — from reading the trace to reproducing locally and using AI.Thu, 11 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicddebuggingtroubleshootingpipelinescihttps://devopsaitoolkit.com/blog/debugging-keystone-identity-auth-openstack/https://devopsaitoolkit.com/blog/debugging-keystone-identity-auth-openstack/401s, token expiry, and role mistakes block every other OpenStack service. Here's how to debug Keystone identity, tokens, and RBAC methodically.Thu, 11 Jun 2026 00:00:00 GMTopenstackopenstackkeystoneidentityauthenticationrbactokenshttps://devopsaitoolkit.com/blog/debugging-neutron-networking-openstack/https://devopsaitoolkit.com/blog/debugging-neutron-networking-openstack/Neutron failures hide behind layers of namespaces, OVS bridges, and security groups. Here's a methodical packet-path approach to debugging OpenStack networking.Thu, 11 Jun 2026 00:00:00 GMTopenstackopenstackneutronnetworkingovstroubleshootingsdnhttps://devopsaitoolkit.com/blog/debugging-systemd-services-that-wont-start/https://devopsaitoolkit.com/blog/debugging-systemd-services-that-wont-start/A failed systemd unit, the commands that actually tell you why, and how to use AI to read the noise so you fix the right thing the first time.Thu, 11 Jun 2026 00:00:00 GMTlinux-adminslinuxsystemddebuggingservicesjournaldsysadminhttps://devopsaitoolkit.com/blog/deploying-openstack-with-kolla-ansible/https://devopsaitoolkit.com/blog/deploying-openstack-with-kolla-ansible/Kolla-Ansible packages OpenStack as containers deployed by Ansible. Here's a practical walkthrough of a clean deployment, the config that matters, and where it bites.Thu, 11 Jun 2026 00:00:00 GMTopenstackopenstackkolla-ansibledeploymentansiblecontainersiachttps://devopsaitoolkit.com/blog/deploying-to-kubernetes-from-gitlab-ci/https://devopsaitoolkit.com/blog/deploying-to-kubernetes-from-gitlab-ci/kubectl apply in a CI job is a footgun. Here's how I deploy to Kubernetes from GitLab using the agent, Helm, environments, and safe rollouts that you can actually trust.Thu, 11 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdkuberneteshelmdeploymentgitopshttps://devopsaitoolkit.com/blog/designing-a-healthy-on-call-rotation-that-doesnt-burn-people-out/https://devopsaitoolkit.com/blog/designing-a-healthy-on-call-rotation-that-doesnt-burn-people-out/On-call burnout is a design problem, not a willpower problem. A veteran SRE's guide to rotation structure, fair load, health metrics, and using AI to reduce noise.Thu, 11 Jun 2026 00:00:00 GMTincident-responseincident-responseon-callsreburnoutrotationalertinghttps://devopsaitoolkit.com/blog/designing-alert-rules-that-dont-page-you-falsely/https://devopsaitoolkit.com/blog/designing-alert-rules-that-dont-page-you-falsely/A pager that cries wolf trains people to ignore it. Here's how I design Prometheus alert rules that fire on real problems and stay quiet otherwise.Thu, 11 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusalertingsreon-callobservabilitymonitoringhttps://devopsaitoolkit.com/blog/designing-incident-escalation-policies-that-actually-reach-someone/https://devopsaitoolkit.com/blog/designing-incident-escalation-policies-that-actually-reach-someone/An escalation policy fails the moment a page goes unanswered. A veteran SRE's guide to tiers, timeouts, fallbacks, and using AI to route the right severity faster.Thu, 11 Jun 2026 00:00:00 GMTincident-responseincident-responseescalationon-callsrepagingalertinghttps://devopsaitoolkit.com/blog/designing-slack-slash-commands-for-devops/https://devopsaitoolkit.com/blog/designing-slack-slash-commands-for-devops/How to design Slack slash commands that DevOps teams actually use — argument parsing, the 3-second ACK rule, deferred responses, and risk-gated actions.Thu, 11 Jun 2026 00:00:00 GMTslackslackslash-commandschatopsdevopsslack-apiautomationhttps://devopsaitoolkit.com/blog/detecting-and-fixing-infrastructure-config-drift/https://devopsaitoolkit.com/blog/detecting-and-fixing-infrastructure-config-drift/Config drift is the silent killer of IaC. Here's how to detect when reality diverges from code, why it happens, and how to close the gap for good.Thu, 11 Jun 2026 00:00:00 GMTiaciacconfig-driftautomationgitopsreliabilityaihttps://devopsaitoolkit.com/blog/diagnosing-high-load-cpu-memory-io-on-linux/https://devopsaitoolkit.com/blog/diagnosing-high-load-cpu-memory-io-on-linux/What load average really means, the tools that separate a CPU problem from an I/O wait problem, and using AI to read the metrics so you fix the actual bottleneck.Thu, 11 Jun 2026 00:00:00 GMTlinux-adminslinuxperformancetroubleshootingcpumemoryiostathttps://devopsaitoolkit.com/blog/fixing-selinux-denials-without-disabling-it/https://devopsaitoolkit.com/blog/fixing-selinux-denials-without-disabling-it/How to read SELinux denials, fix them with contexts and booleans instead of setenforce 0, and use AI to translate audit logs into the right policy fix.Thu, 11 Jun 2026 00:00:00 GMTlinux-adminslinuxselinuxsecurityrheltroubleshootingsysadminhttps://devopsaitoolkit.com/blog/fixing-terraform-state-drift-before-it-bites-you/https://devopsaitoolkit.com/blog/fixing-terraform-state-drift-before-it-bites-you/Drift is what happens between your code and reality when humans touch the console. Here's how I detect it, reconcile it, and stop it from causing failed applies.Thu, 11 Jun 2026 00:00:00 GMTterraformterraformdriftstatereconciliationdevopsautomationhttps://devopsaitoolkit.com/blog/gitlab-ci-secrets-management-oidc/https://devopsaitoolkit.com/blog/gitlab-ci-secrets-management-oidc/Static cloud keys in CI variables are a breach waiting to happen. Here's how I use GitLab OIDC and short-lived credentials to deploy without storing any long-lived secrets.Thu, 11 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdsecretsoidcsecurityawshttps://devopsaitoolkit.com/blog/gitlab-merge-trains-explained/https://devopsaitoolkit.com/blog/gitlab-merge-trains-explained/Two MRs that pass alone can break main together. Here's how GitLab merge trains catch that, when they're worth it, and how I keep the train fast instead of stuck.Thu, 11 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdmerge-trainsmerge-requestsvelocityautomationhttps://devopsaitoolkit.com/blog/gitlab-monorepo-pipelines-child-pipelines-rules/https://devopsaitoolkit.com/blog/gitlab-monorepo-pipelines-child-pipelines-rules/A monorepo that rebuilds everything on every commit is a tax on every developer. Here's how I use rules:changes and child pipelines to build only the affected services.Thu, 11 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdmonorepochild-pipelinesrulesscalinghttps://devopsaitoolkit.com/blog/gitlab-review-apps-ephemeral-environments/https://devopsaitoolkit.com/blog/gitlab-review-apps-ephemeral-environments/Reviewing code in a diff is hard; reviewing a running app is easy. Here's how I set up GitLab Review Apps so every MR gets an ephemeral environment that cleans itself up.Thu, 11 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdreview-appskubernetesenvironmentspreviewhttps://devopsaitoolkit.com/blog/gitlab-runners-autoscaling-kubernetes-executor/https://devopsaitoolkit.com/blog/gitlab-runners-autoscaling-kubernetes-executor/Runners are where GitLab CI actually runs your jobs. Here's how I pick executors, set up autoscaling, and run the Kubernetes executor without burning money or capacity.Thu, 11 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdrunnerskubernetesautoscalinginfrastructurehttps://devopsaitoolkit.com/blog/gitops-for-infrastructure-explained/https://devopsaitoolkit.com/blog/gitops-for-infrastructure-explained/GitOps turns your repo into the single source of truth and a controller into the enforcer. Here's how it works for infrastructure, and where AI helps.Thu, 11 Jun 2026 00:00:00 GMTiaciacgitopsargocdfluxautomationkuberneteshttps://devopsaitoolkit.com/blog/gitops-with-argo-cd-a-practical-starting-guide/https://devopsaitoolkit.com/blog/gitops-with-argo-cd-a-practical-starting-guide/GitOps makes Git the source of truth for your cluster. Here's how to set up Argo CD the right way — repo structure, sync policies, drift — with AI to review changes.Thu, 11 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesgitopsargo-cdcicdaiautomationhttps://devopsaitoolkit.com/blog/hardening-ssh-access-production-servers-with-ai/https://devopsaitoolkit.com/blog/hardening-ssh-access-production-servers-with-ai/SSH is the front door to every server you run. Here's how I lock it down — key-only auth, sane ciphers, bastion patterns — and use AI to audit the config without breaking access.Thu, 11 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningsshlinuxaccess-controlaihttps://devopsaitoolkit.com/blog/hardening-ssh-on-linux-servers/https://devopsaitoolkit.com/blog/hardening-ssh-on-linux-servers/The sshd_config changes that actually reduce attack surface, how to roll them out without locking yourself out, and using AI to audit your config.Thu, 11 Jun 2026 00:00:00 GMTlinux-adminslinuxsshsecurityhardeningsshdsysadminhttps://devopsaitoolkit.com/blog/how-to-write-a-blameless-postmortem-that-people-actually-read/https://devopsaitoolkit.com/blog/how-to-write-a-blameless-postmortem-that-people-actually-read/A blameless postmortem is only useful if it changes behavior. Here's a veteran SRE's template, facilitation tips, and how AI helps draft without flattening the nuance.Thu, 11 Jun 2026 00:00:00 GMTpostmortemsincident-responsepostmortemsreblamelesson-callreliabilityhttps://devopsaitoolkit.com/blog/iac-testing-strategies-that-actually-work/https://devopsaitoolkit.com/blog/iac-testing-strategies-that-actually-work/A layered approach to testing infrastructure as code — from static checks to integration tests — and where AI speeds up writing the test suite.Thu, 11 Jun 2026 00:00:00 GMTiaciactestingci-cdautomationqualityaihttps://devopsaitoolkit.com/blog/incident-severity-classification-a-practical-sev1-to-sev4-guide/https://devopsaitoolkit.com/blog/incident-severity-classification-a-practical-sev1-to-sev4-guide/Severity levels decide who wakes up and how fast you move. Here's a clear, real-world rubric for SEV1-SEV4, common mistakes, and how AI helps classify under pressure.Thu, 11 Jun 2026 00:00:00 GMTincident-responseincident-responseseveritysreon-calltriageescalationhttps://devopsaitoolkit.com/blog/integrate-azure-devops-and-pagerduty-with-microsoft-teams/https://devopsaitoolkit.com/blog/integrate-azure-devops-and-pagerduty-with-microsoft-teams/Wire Azure DevOps pipelines and PagerDuty incidents into Teams so the whole loop — build, page, acknowledge, resolve — happens where your team already works.Thu, 11 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsazure-devopspagerdutychatopsci-cdon-callhttps://devopsaitoolkit.com/blog/integrating-slack-with-pagerduty-and-jira/https://devopsaitoolkit.com/blog/integrating-slack-with-pagerduty-and-jira/Connect Slack, PagerDuty, and Jira so pages, incidents, and follow-up tickets flow in one loop — with the right automation and the right manual gates.Thu, 11 Jun 2026 00:00:00 GMTslackslackpagerdutyjiraintegrationincident-responsechatopshttps://devopsaitoolkit.com/blog/kubernetes-ingress-and-the-gateway-api-explained/https://devopsaitoolkit.com/blog/kubernetes-ingress-and-the-gateway-api-explained/Ingress got you this far, but the Gateway API is where routing is headed. Here's how both work, when to migrate, and how AI helps debug routing that won't route.Thu, 11 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesingressgateway-apinetworkingairoutinghttps://devopsaitoolkit.com/blog/kubernetes-network-policies-default-deny-and-beyond/https://devopsaitoolkit.com/blog/kubernetes-network-policies-default-deny-and-beyond/By default every pod can talk to every other pod. Network Policies fix that. Here's how to roll out default-deny safely, with AI help reasoning about traffic flows.Thu, 11 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesnetwork-policysecuritynetworkingaizero-trusthttps://devopsaitoolkit.com/blog/kubernetes-rbac-without-the-headaches/https://devopsaitoolkit.com/blog/kubernetes-rbac-without-the-headaches/RBAC is where most clusters quietly grant cluster-admin to everything. Here's how to design least-privilege access that's auditable, with AI to reason about permission scope.Thu, 11 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesrbacsecurityaccess-controlaileast-privilegehttps://devopsaitoolkit.com/blog/kubernetes-security-hardening-pod-rbac-network-policy/https://devopsaitoolkit.com/blog/kubernetes-security-hardening-pod-rbac-network-policy/A default Kubernetes cluster is dangerously permissive. Here's how I harden pods, RBAC, and network policy so one compromised container can't become the whole cluster — with AI auditing the manifests.Thu, 11 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningkubernetesrbacnetwork-policyaihttps://devopsaitoolkit.com/blog/large-terraform-refactors-with-moved-and-import-blocks/https://devopsaitoolkit.com/blog/large-terraform-refactors-with-moved-and-import-blocks/Renaming resources or absorbing existing infra used to mean scary state surgery. Moved and import blocks make large refactors reviewable and safe. Here's my playbook.Thu, 11 Jun 2026 00:00:00 GMTterraformterraformrefactoringmoved-blocksimportstatedevopshttps://devopsaitoolkit.com/blog/long-term-prometheus-storage-thanos-vs-mimir/https://devopsaitoolkit.com/blog/long-term-prometheus-storage-thanos-vs-mimir/Prometheus keeps weeks of data, not years. Here's how Thanos and Mimir give you durable, queryable, long-term metrics — and how to choose.Thu, 11 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusthanosmimirstorageobservabilitymonitoringhttps://devopsaitoolkit.com/blog/managing-lvm-and-resizing-disks-on-linux/https://devopsaitoolkit.com/blog/managing-lvm-and-resizing-disks-on-linux/How LVM actually layers, the exact command order to grow a volume online, and using AI to sanity-check disk operations before you run something irreversible.Thu, 11 Jun 2026 00:00:00 GMTlinux-adminslinuxlvmstoragefilesystemdisksysadminhttps://devopsaitoolkit.com/blog/managing-on-call-handoffs-in-slack/https://devopsaitoolkit.com/blog/managing-on-call-handoffs-in-slack/A practical Slack workflow for on-call handoffs — structured shift summaries, open-issue carryover, and AI-assisted recaps that keep context intact.Thu, 11 Jun 2026 00:00:00 GMTslackslackon-callhandoffsrechatopsreliabilityhttps://devopsaitoolkit.com/blog/managing-secrets-in-infrastructure-as-code/https://devopsaitoolkit.com/blog/managing-secrets-in-infrastructure-as-code/Secrets in IaC are where good intentions go to die in git history. Here's a practical approach to secret management across tools — and the AI guardrails to use.Thu, 11 Jun 2026 00:00:00 GMTiaciacsecretssecurityvaultencryptiongitopshttps://devopsaitoolkit.com/blog/managing-secrets-in-terraform-without-leaking-them/https://devopsaitoolkit.com/blog/managing-secrets-in-terraform-without-leaking-them/Terraform writes every secret it touches into state in plaintext. Here's how I keep credentials out of code and state, and reference them safely instead.Thu, 11 Jun 2026 00:00:00 GMTterraformterraformsecretssecurityvaultstatedevopshttps://devopsaitoolkit.com/blog/managing-secrets-with-vault-and-sealed-secrets/https://devopsaitoolkit.com/blog/managing-secrets-with-vault-and-sealed-secrets/Secrets in plaintext env files and git repos are how breaches start. Here's how I run Vault and Sealed Secrets in production — plus how AI helps audit for leaked credentials.Thu, 11 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningsecrets-managementvaultkubernetesaihttps://devopsaitoolkit.com/blog/managing-sudo-and-linux-permissions-safely/https://devopsaitoolkit.com/blog/managing-sudo-and-linux-permissions-safely/How to grant least-privilege sudo access, read permission and ownership the way the kernel does, and use AI to audit sudoers without breaking root access.Thu, 11 Jun 2026 00:00:00 GMTlinux-adminslinuxsudopermissionssecuritysysadminaccess-controlhttps://devopsaitoolkit.com/blog/microsoft-graph-api-automation-for-teams-devops/https://devopsaitoolkit.com/blog/microsoft-graph-api-automation-for-teams-devops/The Graph API lets you create channels, post messages, and manage Teams programmatically. Here's how DevOps teams use it for incident automation safely.Thu, 11 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsmicrosoft-graphapiautomationincident-responseoauthhttps://devopsaitoolkit.com/blog/migrate-teams-incoming-webhooks-to-workflows/https://devopsaitoolkit.com/blog/migrate-teams-incoming-webhooks-to-workflows/Microsoft is retiring Office 365 connector webhooks. Here's how to migrate your DevOps notifications to Workflows without losing adaptive card formatting.Thu, 11 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsworkflowswebhookspower-automatemigrationalertinghttps://devopsaitoolkit.com/blog/migrating-from-terraform-to-opentofu-a-practical-guide/https://devopsaitoolkit.com/blog/migrating-from-terraform-to-opentofu-a-practical-guide/Evaluating the OpenTofu fork? Here's how I assess the switch, run the migration safely on a large estate, and decide whether it's worth it for your team.Thu, 11 Jun 2026 00:00:00 GMTterraformterraformopentofumigrationiactoolingdevopshttps://devopsaitoolkit.com/blog/monitoring-openstack-with-prometheus/https://devopsaitoolkit.com/blog/monitoring-openstack-with-prometheus/OpenStack has dozens of moving parts and few useful defaults. Here's a practical Prometheus monitoring stack for OpenStack — exporters, key alerts, and SLOs that matter.Thu, 11 Jun 2026 00:00:00 GMTopenstackopenstackprometheusmonitoringgrafanaobservabilitysrehttps://devopsaitoolkit.com/blog/multi-environment-promotion-for-infrastructure/https://devopsaitoolkit.com/blog/multi-environment-promotion-for-infrastructure/How to promote infrastructure changes from dev to staging to prod safely — without copy-pasted config, drift, or 'works in staging' surprises.Thu, 11 Jun 2026 00:00:00 GMTiaciacpromotionenvironmentsci-cdgitopsreliabilityhttps://devopsaitoolkit.com/blog/parsing-arguments-in-bash-scripts-the-right-way/https://devopsaitoolkit.com/blog/parsing-arguments-in-bash-scripts-the-right-way/Positional args break the moment someone passes flags out of order. Here's how to parse bash arguments with getopts and a hand-rolled loop that handles long options.Thu, 11 Jun 2026 00:00:00 GMTbash-python-automationbashpythongetoptscliscriptingautomationhttps://devopsaitoolkit.com/blog/parsing-logs-with-bash-and-python-scripts/https://devopsaitoolkit.com/blog/parsing-logs-with-bash-and-python-scripts/From a quick grep one-liner to a structured Python parser, here's how to extract signal from log files at any scale, plus where AI speeds up writing the parser.Thu, 11 Jun 2026 00:00:00 GMTbash-python-automationbashpythonlogsawkregexautomationhttps://devopsaitoolkit.com/blog/persistent-storage-in-kubernetes-pvcs-storageclasses-statefulsets/https://devopsaitoolkit.com/blog/persistent-storage-in-kubernetes-pvcs-storageclasses-statefulsets/Storage is where stateless Kubernetes intuition breaks down. Here's how PVs, PVCs, StorageClasses, and StatefulSets fit together, with AI help debugging stuck volumes.Thu, 11 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesstoragepvcstatefulsetaidatabaseshttps://devopsaitoolkit.com/blog/planning-openstack-upgrades-safely/https://devopsaitoolkit.com/blog/planning-openstack-upgrades-safely/OpenStack upgrades fail on the boring details: DB migrations, RPC version pinning, and ordering. Here's a battle-tested plan for upgrading without taking the cloud down.Thu, 11 Jun 2026 00:00:00 GMTopenstackopenstackupgradesoperationsdatabaserolling-upgradesrehttps://devopsaitoolkit.com/blog/policy-as-code-with-opa-and-conftest/https://devopsaitoolkit.com/blog/policy-as-code-with-opa-and-conftest/Stop catching bad infrastructure config in code review. Here's how to enforce IaC guardrails automatically with OPA and Conftest — and let AI write the Rego.Thu, 11 Jun 2026 00:00:00 GMTiaciacpolicy-as-codeopaconftestregosecurityhttps://devopsaitoolkit.com/blog/power-automate-for-devops-workflows-in-microsoft-teams/https://devopsaitoolkit.com/blog/power-automate-for-devops-workflows-in-microsoft-teams/Power Automate is more capable than DevOps engineers give it credit for. Here are the flows I actually use for on-call, deploys, and approvals in Teams.Thu, 11 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamspower-automatedevopsautomationworkflowschatopshttps://devopsaitoolkit.com/blog/prometheus-recording-rules-that-make-queries-fast/https://devopsaitoolkit.com/blog/prometheus-recording-rules-that-make-queries-fast/Recording rules precompute expensive PromQL so dashboards and alerts stay snappy. Here's how I decide what to record and how to name it.Thu, 11 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusrecording-rulespromqlperformancesremonitoringhttps://devopsaitoolkit.com/blog/reducing-mttr-where-the-time-actually-goes-and-how-to-cut-it/https://devopsaitoolkit.com/blog/reducing-mttr-where-the-time-actually-goes-and-how-to-cut-it/MTTR is dominated by detection and diagnosis, not the fix. A veteran SRE breaks down each phase, where the minutes hide, and how AI compresses the slow parts.Thu, 11 Jun 2026 00:00:00 GMTreduce-mttrincident-responsemttrsreon-callobservabilityreliabilityhttps://devopsaitoolkit.com/blog/retry-and-backoff-patterns-for-automation-scripts/https://devopsaitoolkit.com/blog/retry-and-backoff-patterns-for-automation-scripts/Networks blip, APIs rate-limit, services restart. Here's how to add retry with exponential backoff and jitter to bash and Python so transient failures don't page you.Thu, 11 Jun 2026 00:00:00 GMTbash-python-automationbashpythonretrybackoffautomationreliabilityhttps://devopsaitoolkit.com/blog/reusable-gitlab-ci-components-catalog/https://devopsaitoolkit.com/blog/reusable-gitlab-ci-components-catalog/Every team copy-pastes the same CI jobs until they drift. Here's how I use GitLab's CI/CD Components and Catalog to ship versioned, reusable pipeline building blocks.Thu, 11 Jun 2026 00:00:00 GMTgitlab-cicdgitlabcicdcomponentscatalogtemplatesplatform-engineeringhttps://devopsaitoolkit.com/blog/right-sizing-pods-resource-requests-limits-and-autoscaling/https://devopsaitoolkit.com/blog/right-sizing-pods-resource-requests-limits-and-autoscaling/Bad requests and limits cause both OOMKills and wasted spend. Here's how to set them correctly and wire up HPA and VPA, with AI to reason about real usage data.Thu, 11 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesautoscalinghpavparesourcesaihttps://devopsaitoolkit.com/blog/route-alerts-to-microsoft-teams-with-adaptive-cards/https://devopsaitoolkit.com/blog/route-alerts-to-microsoft-teams-with-adaptive-cards/Plain-text Teams alerts get ignored. Here's how to route Prometheus and Azure Monitor alerts into rich adaptive cards with severity, context, and one-click actions.Thu, 11 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsadaptive-cardsalertingchatopsprometheusobservabilityhttps://devopsaitoolkit.com/blog/routing-monitoring-alerts-to-slack-without-the-noise/https://devopsaitoolkit.com/blog/routing-monitoring-alerts-to-slack-without-the-noise/How to route Prometheus and Alertmanager alerts to Slack channels cleanly — severity routing, grouping, dedup, and AI summaries that beat alert fatigue.Thu, 11 Jun 2026 00:00:00 GMTslackslackalertingprometheusalertmanagerobservabilityon-callhttps://devopsaitoolkit.com/blog/running-gamedays-and-chaos-experiments-without-breaking-production/https://devopsaitoolkit.com/blog/running-gamedays-and-chaos-experiments-without-breaking-production/Gamedays and chaos engineering find weaknesses before customers do. A veteran SRE's guide to safe experiments, blast-radius control, and AI-assisted planning.Thu, 11 Jun 2026 00:00:00 GMTincident-responseincident-responsegamedaychaos-engineeringsreresilienceon-callhttps://devopsaitoolkit.com/blog/running-incident-war-rooms-in-microsoft-teams-channels/https://devopsaitoolkit.com/blog/running-incident-war-rooms-in-microsoft-teams-channels/A dedicated Teams channel per incident keeps the war room organized. Here's how I structure incident channels, roles, and bots so they stay usable under pressure.Thu, 11 Jun 2026 00:00:00 GMTmicrosoft-teamsmicrosoft-teamsincident-responsewar-roomchatopson-callsrehttps://devopsaitoolkit.com/blog/running-terraform-safely-in-ci-cd-pipelines/https://devopsaitoolkit.com/blog/running-terraform-safely-in-ci-cd-pipelines/Letting CI run terraform apply unattended is powerful and terrifying. Here's the pipeline structure, gates, and credential handling I use to do it without blowing up prod.Thu, 11 Jun 2026 00:00:00 GMTterraformterraformci-cdautomationpipelinesdevopsgitopshttps://devopsaitoolkit.com/blog/scheduling-scripts-systemd-timers-vs-cron/https://devopsaitoolkit.com/blog/scheduling-scripts-systemd-timers-vs-cron/cron is everywhere but logs nowhere. Here's a practical comparison of systemd timers and cron for scheduling automation scripts, with config examples for both.Thu, 11 Jun 2026 00:00:00 GMTbash-python-automationbashpythonsystemdcronschedulingautomationhttps://devopsaitoolkit.com/blog/securing-a-kubernetes-cluster-pod-security-and-admission-control/https://devopsaitoolkit.com/blog/securing-a-kubernetes-cluster-pod-security-and-admission-control/Pod Security Standards and admission controllers stop dangerous workloads before they run. Here's how to lock down a cluster without breaking deploys, with AI help.Thu, 11 Jun 2026 00:00:00 GMTkubernetes-helmkubernetessecuritypod-securityadmission-controlaipolicyhttps://devopsaitoolkit.com/blog/securing-cicd-pipelines-against-supply-chain-attacks/https://devopsaitoolkit.com/blog/securing-cicd-pipelines-against-supply-chain-attacks/Your CI/CD pipeline has more production access than most engineers. Here's how I harden runners, scope tokens, and pin actions — plus using AI to audit pipeline config for risk.Thu, 11 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningcicdpipelinegithub-actionsaihttps://devopsaitoolkit.com/blog/securing-slack-webhooks-and-tokens/https://devopsaitoolkit.com/blog/securing-slack-webhooks-and-tokens/How to secure Slack incoming webhooks and app tokens — signature verification, secret storage, scope minimization, rotation, and leak response.Thu, 11 Jun 2026 00:00:00 GMTslackslacksecuritywebhookssecretsdevopshardeninghttps://devopsaitoolkit.com/blog/slack-block-kit-message-design-for-ops/https://devopsaitoolkit.com/blog/slack-block-kit-message-design-for-ops/A practical guide to Block Kit for DevOps — headers, fields, sections, and actions that turn raw ops output into messages people read at a glance.Thu, 11 Jun 2026 00:00:00 GMTslackslackblock-kitchatopsuxalertingdevopshttps://devopsaitoolkit.com/blog/slos-and-error-budgets-with-prometheus/https://devopsaitoolkit.com/blog/slos-and-error-budgets-with-prometheus/SLOs turn 'is it healthy?' into a number you can act on. Here's how I define SLIs, set realistic SLOs, and compute error budgets in PromQL.Thu, 11 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusslosreerror-budgetreliabilitymonitoringhttps://devopsaitoolkit.com/blog/status-page-communication-during-incidents-templates-and-cadence/https://devopsaitoolkit.com/blog/status-page-communication-during-incidents-templates-and-cadence/Good incident comms build trust; bad ones erode it faster than the outage. A veteran SRE's templates, cadence rules, and AI prompts for status-page updates.Thu, 11 Jun 2026 00:00:00 GMTincident-responseincident-responsecommunicationstatus-pagesreon-callcustomer-trusthttps://devopsaitoolkit.com/blog/structured-logging-in-bash-and-python-automation/https://devopsaitoolkit.com/blog/structured-logging-in-bash-and-python-automation/echo statements don't scale past one machine. Here's how to add leveled, structured JSON logging to bash and Python so your automation is searchable and debuggable.Thu, 11 Jun 2026 00:00:00 GMTbash-python-automationbashpythonloggingjsonobservabilityautomationhttps://devopsaitoolkit.com/blog/structuring-terraform-state-and-remote-backends-that-scale/https://devopsaitoolkit.com/blog/structuring-terraform-state-and-remote-backends-that-scale/State is the single most dangerous file in your Terraform estate. Here's how I structure backends, split state, and lock things down so a large org doesn't corrupt itself.Thu, 11 Jun 2026 00:00:00 GMTterraformterraformstatebackendss3infrastructuredevopshttps://devopsaitoolkit.com/blog/supply-chain-security-sbom-sigstore-signing/https://devopsaitoolkit.com/blog/supply-chain-security-sbom-sigstore-signing/You can't secure software you can't inventory. Here's how I generate SBOMs, sign artifacts with Sigstore, verify provenance, and use AI to make supply-chain data actionable.Thu, 11 Jun 2026 00:00:00 GMTsecurity-hardeningsecurityhardeningsupply-chainsbomsigstoreaihttps://devopsaitoolkit.com/blog/surviving-terraform-provider-version-upgrades/https://devopsaitoolkit.com/blog/surviving-terraform-provider-version-upgrades/Major provider upgrades break plans in subtle ways across a large estate. Here's how I roll them out incrementally with lock files, pins, and read-only validation.Thu, 11 Jun 2026 00:00:00 GMTterraformterraformprovidersupgradesversioninglockfiledevopshttps://devopsaitoolkit.com/blog/taming-prometheus-metric-cardinality/https://devopsaitoolkit.com/blog/taming-prometheus-metric-cardinality/High cardinality is the number one way to kill a Prometheus server. Here's how I find the offending labels and cut cardinality without losing signal.Thu, 11 Jun 2026 00:00:00 GMTprometheus-monitoringprometheuscardinalityperformanceobservabilitysremonitoringhttps://devopsaitoolkit.com/blog/terraform-for-each-vs-count-choosing-the-right-one/https://devopsaitoolkit.com/blog/terraform-for-each-vs-count-choosing-the-right-one/Pick the wrong iteration construct and a single list change destroys and recreates half your resources. Here's when to use for_each, when count is fine, and why.Thu, 11 Jun 2026 00:00:00 GMTterraformterraformfor_eachcountiterationhcldevopshttps://devopsaitoolkit.com/blog/testing-shell-and-python-scripts-with-bats-and-pytest/https://devopsaitoolkit.com/blog/testing-shell-and-python-scripts-with-bats-and-pytest/Untested automation scripts fail in production where it hurts most. Here's how to test bash with bats and Python with pytest, including mocking risky commands.Thu, 11 Jun 2026 00:00:00 GMTbash-python-automationbashpythontestingbatspytestautomationhttps://devopsaitoolkit.com/blog/testing-terraform-from-validate-to-native-tests/https://devopsaitoolkit.com/blog/testing-terraform-from-validate-to-native-tests/Infrastructure code deserves tests too. Here's the layered approach I use — fmt, validate, policy checks, and native terraform test — to catch failures before apply.Thu, 11 Jun 2026 00:00:00 GMTterraformterraformtestingvalidationpolicycidevopshttps://devopsaitoolkit.com/blog/the-incident-commander-role-explained-for-engineering-teams/https://devopsaitoolkit.com/blog/the-incident-commander-role-explained-for-engineering-teams/The incident commander coordinates, doesn't fix. A veteran SRE breaks down the role, the first five minutes, common mistakes, and where AI lightens the load.Thu, 11 Jun 2026 00:00:00 GMTincident-responseincident-responseincident-commandersreon-callleadershipcoordinationhttps://devopsaitoolkit.com/blog/troubleshooting-cinder-block-storage-openstack/https://devopsaitoolkit.com/blog/troubleshooting-cinder-block-storage-openstack/Stuck volumes, failed attachments, and phantom 'in-use' states are the daily reality of Cinder. Here's how to diagnose and recover OpenStack block storage safely.Thu, 11 Jun 2026 00:00:00 GMTopenstackopenstackcinderstoragevolumestroubleshootingiscsihttps://devopsaitoolkit.com/blog/troubleshooting-kubernetes-dns-and-service-networking/https://devopsaitoolkit.com/blog/troubleshooting-kubernetes-dns-and-service-networking/It's always DNS. Here's a systematic way to debug Kubernetes service discovery and networking failures, from CoreDNS to kube-proxy, with AI to read the evidence.Thu, 11 Jun 2026 00:00:00 GMTkubernetes-helmkubernetesdnsnetworkingcorednsaitroubleshootinghttps://devopsaitoolkit.com/blog/troubleshooting-linux-network-connectivity/https://devopsaitoolkit.com/blog/troubleshooting-linux-network-connectivity/A repeatable method for 'I can't connect' problems — interface, route, DNS, port, firewall — and using AI to read ss, ip, and tcpdump output fast.Thu, 11 Jun 2026 00:00:00 GMTlinux-adminslinuxnetworkingtroubleshootingdnsfirewallsysadminhttps://devopsaitoolkit.com/blog/troubleshooting-nova-compute-failures-openstack/https://devopsaitoolkit.com/blog/troubleshooting-nova-compute-failures-openstack/When an OpenStack instance won't boot, the error is rarely where you first look. Here's a field-tested order for tracing Nova compute failures from API to hypervisor.Thu, 11 Jun 2026 00:00:00 GMTopenstackopenstacknovacomputetroubleshootingkvmlibvirthttps://devopsaitoolkit.com/blog/troubleshooting-openstack-live-migration/https://devopsaitoolkit.com/blog/troubleshooting-openstack-live-migration/Live migration keeps instances running during maintenance — until it stalls or fails. Here's how to diagnose Nova live migration across CPU, storage, and network.Thu, 11 Jun 2026 00:00:00 GMTopenstackopenstacknovalive-migrationkvmlibvirtoperationshttps://devopsaitoolkit.com/blog/troubleshooting-rabbitmq-in-openstack/https://devopsaitoolkit.com/blog/troubleshooting-rabbitmq-in-openstack/RabbitMQ is OpenStack's nervous system, and when it backs up the whole cloud stalls. Here's how to diagnose queue backlogs, partitions, and stuck consumers.Thu, 11 Jun 2026 00:00:00 GMTopenstackopenstackrabbitmqmessagingtroubleshootingoslo-messagingoperationshttps://devopsaitoolkit.com/blog/writing-idempotent-automation-scripts/https://devopsaitoolkit.com/blog/writing-idempotent-automation-scripts/An automation script you can't safely run twice isn't automation, it's a one-shot. Here's how to make bash and Python scripts idempotent so re-runs are no-ops.Thu, 11 Jun 2026 00:00:00 GMTbash-python-automationbashpythonidempotencyautomationinfrastructurescriptinghttps://devopsaitoolkit.com/blog/writing-maintainable-ansible-playbooks-with-ai/https://devopsaitoolkit.com/blog/writing-maintainable-ansible-playbooks-with-ai/Most Ansible playbooks rot because they grow by accretion. Here's how to structure playbooks for the long haul and where AI actually speeds up the work.Thu, 11 Jun 2026 00:00:00 GMTansibleiacansibleaiconfiguration-managementautomationbest-practiceshttps://devopsaitoolkit.com/blog/writing-prometheus-exporters-and-choosing-existing-ones/https://devopsaitoolkit.com/blog/writing-prometheus-exporters-and-choosing-existing-ones/Exporters turn anything into Prometheus metrics. Here's how I pick a good off-the-shelf exporter and write a custom one when none exists.Thu, 11 Jun 2026 00:00:00 GMTprometheus-monitoringprometheusexportersinstrumentationobservabilitysremonitoringhttps://devopsaitoolkit.com/blog/best-devsecops-security-tools-cicd-pipeline-protection/https://devopsaitoolkit.com/blog/best-devsecops-security-tools-cicd-pipeline-protection/A practical, category-by-category guide to the DevSecOps tools that actually protect your CI/CD pipeline — SAST, SCA, secrets, IaC, policy, and runtime.Wed, 10 Jun 2026 00:00:00 GMTgitlab-cicddevsecopsci-cdsecuritysastcontainer-scanningsupply-chainpipelineshttps://devopsaitoolkit.com/blog/devops-as-a-service-pricing-what-to-expect/https://devopsaitoolkit.com/blog/devops-as-a-service-pricing-what-to-expect/What does DevOps as a Service actually cost? A breakdown of pricing models, the factors that move the number, and how to calculate ROI before you sign.Wed, 10 Jun 2026 00:00:00 GMTiacdevopspricingmanaged-devopsroicloud-costci-cdstartupshttps://devopsaitoolkit.com/blog/devops-security-best-practices-engineering-teams/https://devopsaitoolkit.com/blog/devops-security-best-practices-engineering-teams/Security isn't a separate department's job — it's a daily engineering discipline. Here's the practical, blue-team checklist every DevOps team should build into their workflow.Wed, 10 Jun 2026 00:00:00 GMTsecurity-hardeningsecuritydevsecopshardeningsecrets-managementci-cdkubernetescloudhttps://devopsaitoolkit.com/blog/how-to-choose-devops-as-a-service-provider/https://devopsaitoolkit.com/blog/how-to-choose-devops-as-a-service-provider/DevOps as a Service can buy you maturity, on-call coverage, and senior judgment you can't easily hire. Here's how to pick a provider who's actually run production.Wed, 10 Jun 2026 00:00:00 GMTiacdevopsmanaged-devopsci-cdkubernetescloudautomationhiringhttps://devopsaitoolkit.com/blog/how-devops-engineers-can-use-ai-to-triage-production-incidents-faster/https://devopsaitoolkit.com/blog/how-devops-engineers-can-use-ai-to-triage-production-incidents-faster/The slowest part of most incidents isn't the fix — it's the first 15 minutes of figuring out what's actually broken. Here's how to use AI to compress triage without letting it touch production.Sat, 06 Jun 2026 00:00:00 GMTincident-responseincident-responseaisreon-calltroubleshootingobservabilityhttps://devopsaitoolkit.com/blog/securing-ai-generated-bash-scripts/https://devopsaitoolkit.com/blog/securing-ai-generated-bash-scripts/AI writes bash quickly and confidently. It also writes bash that destroys filesystems, exposes secrets, and silently swallows errors. Here's the checklist before you run anything an AI wrote.Thu, 28 May 2026 00:00:00 GMTsecurity-hardeningbashsecurityaiscriptingsafetyhttps://devopsaitoolkit.com/blog/reading-loki-logs-with-ai/https://devopsaitoolkit.com/blog/reading-loki-logs-with-ai/Loki query syntax is unfamiliar to most engineers. AI can help write LogQL, but it can also produce queries that look right and return nothing. Here's how to use it well.Mon, 25 May 2026 00:00:00 GMTprometheus-monitoringlokilogslogqlaiobservabilityhttps://devopsaitoolkit.com/blog/why-ai-loves-ansible/https://devopsaitoolkit.com/blog/why-ai-loves-ansible/Ansible's declarative, idempotent, well-documented structure makes it the easiest infrastructure tool for AI to assist with. Here's how to make the most of it.Fri, 22 May 2026 00:00:00 GMTansibleansibleaiautomationplaybookshttps://devopsaitoolkit.com/blog/ai-for-gitlab-ci-authoring/https://devopsaitoolkit.com/blog/ai-for-gitlab-ci-authoring/GitLab CI YAML is dense and easy to get wrong. AI can write 80% of a pipeline in seconds — but the 20% it gets wrong will burn you if you don't know what to look for.Wed, 20 May 2026 00:00:00 GMTgitlab-cicdgitlabci-cdaipipelineshttps://devopsaitoolkit.com/blog/ai-with-terraform-plans/https://devopsaitoolkit.com/blog/ai-with-terraform-plans/Reviewing a 400-line Terraform plan output is tedious and error-prone. AI helps — but only if you give it the right format and ask the right question.Mon, 18 May 2026 00:00:00 GMTterraformterraformaiplanreviewhttps://devopsaitoolkit.com/blog/auditing-kubernetes-manifests-with-ai/https://devopsaitoolkit.com/blog/auditing-kubernetes-manifests-with-ai/AI is surprisingly good at reviewing Kubernetes YAML — if you prompt it right. Here's a workflow that catches real issues without false-positive noise.Fri, 15 May 2026 00:00:00 GMTkubernetes-helmkubernetesyamlsecurityaireviewhttps://devopsaitoolkit.com/blog/ai-incident-response-3am/https://devopsaitoolkit.com/blog/ai-incident-response-3am/When you're paged at 3 AM, generic LLM advice wastes time. Here's what AI is genuinely good at during incidents — and where it makes things worse.Tue, 12 May 2026 00:00:00 GMTincident-responseincident-responsesreaiclaudechatgpthttps://devopsaitoolkit.com/blog/ai-prompt-templates-prometheus-alerting/https://devopsaitoolkit.com/blog/ai-prompt-templates-prometheus-alerting/Production-ready prompt templates for generating Prometheus alert rules with proper thresholds, runbook annotations, and false-positive analysis.Tue, 07 Apr 2026 00:00:00 GMTprometheus-monitoringprometheusalertingpromqlaisrehttps://devopsaitoolkit.com/blog/claude-linux-troubleshooting/https://devopsaitoolkit.com/blog/claude-linux-troubleshooting/A practical, copy-pasteable workflow for using Claude to diagnose production Linux issues — including the prompt structure, what to paste, and what not to.Mon, 06 Apr 2026 00:00:00 GMTlinux-adminsclaudelinuxtroubleshootingsrehttps://devopsaitoolkit.com/blog/best-ai-tools-for-devops-engineers/https://devopsaitoolkit.com/blog/best-ai-tools-for-devops-engineers/An honest, hands-on review of the AI assistants that actually help DevOps engineers, SREs, and cloud admins do real infrastructure work in 2026.Sun, 05 Apr 2026 00:00:00 GMTlinux-adminsaidevopstoolsclaudechatgptcursorhttps://devopsaitoolkit.com/blog/chatgpt-vs-claude-for-infrastructure/https://devopsaitoolkit.com/blog/chatgpt-vs-claude-for-infrastructure/A side-by-side comparison of ChatGPT and Claude for real infrastructure work — Linux troubleshooting, IaC, alerting, postmortems, and Kubernetes.Sat, 04 Apr 2026 00:00:00 GMTlinux-adminschatgptclaudecomparisonaidevopshttps://devopsaitoolkit.com/blog/ai-safely-with-bash/https://devopsaitoolkit.com/blog/ai-safely-with-bash/A practical safety guide for using AI assistants to generate Bash commands in production — the patterns, prompts, and pitfalls that keep you out of trouble.Fri, 03 Apr 2026 00:00:00 GMTbash-python-automationbashsafetyaishellproduction